SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_44491| Best HMM Match : Lipase_GDSL (HMM E-Value=4.5e-05)           30   1.6  
SB_34084| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.2  
SB_11758| Best HMM Match : DUF1518 (HMM E-Value=3.8)                   30   2.2  
SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0)                      29   3.8  
SB_33924| Best HMM Match : DUF310 (HMM E-Value=4.2)                    28   6.6  
SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07)                 28   6.6  

>SB_44491| Best HMM Match : Lipase_GDSL (HMM E-Value=4.5e-05)
          Length = 720

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 14/37 (37%), Positives = 21/37 (56%)
 Frame = -2

Query: 569 VHYKRRHFARFHYRFLRNLLYNVRALRQNNGPKFGIN 459
           ++ K     R HY F  N +  VR L+QN  PK+G++
Sbjct: 40  INLKATQVCRKHY-FRTNGIIRVRVLQQNEQPKYGVD 75


>SB_34084| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 261

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +3

Query: 333 VDEAGEHNMGVLKIIIDTVIKYIGKLADDE 422
           VD+ GEHNMGV K+  D +   + K+A+D+
Sbjct: 33  VDKVGEHNMGVDKVSEDDI--GVDKVAEDD 60


>SB_11758| Best HMM Match : DUF1518 (HMM E-Value=3.8)
          Length = 677

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 28/119 (23%), Positives = 48/119 (40%)
 Frame = +3

Query: 84  LDTSSTSELQSNAST*QLFRSR*RKRHVAHDRVKQRVFKRARKIVLSALVAQRSSRGRKT 263
           L TS T +    +   +++ S  R   +  D  ++ ++ R   +V S   AQ S    KT
Sbjct: 46  LSTSETEKRNFQSEKWKIYSSS-RNDGLGGDVCEEELYVRGNTVVWSQGAAQDSWVPVKT 104

Query: 264 ILNADDVYECVLIKPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKYIGKLADDEYILIAD 440
                +V E +  K       +  +E G+H       I   +I Y+G +  D+   I D
Sbjct: 105 FTVNSEVVEAIWCKFSLPSADK--EEKGKHKDPSAVFIASIIIDYVGVVVQDKVSYICD 161


>SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0)
          Length = 1291

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -2

Query: 566  HYKRRHFARFHYRFLRNLLYNVRALRQN 483
            H+   H+  FHYR LR+  ++ R LR +
Sbjct: 999  HHHHYHYHPFHYRLLRHHSFHYRLLRHH 1026


>SB_33924| Best HMM Match : DUF310 (HMM E-Value=4.2)
          Length = 326

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 3/49 (6%)
 Frame = +2

Query: 485 FASERVHYKGDYAESDSESGQSVDV---CNELKYPWNLITANSFIVSTD 622
           F  E +   G+  E D+ S     +    +E KYPWN++    F+ S D
Sbjct: 79  FFMEVMKANGENYEPDTISSYQRSIQRFLDEAKYPWNILKDKEFVESRD 127


>SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07)
          Length = 493

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +1

Query: 22  LCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDP 147
           +C S   +  +PM P   +  W+  RRA    TRP  NY+ P
Sbjct: 40  VCHSRHRSTIRPMVPGGLLSMWLLERRAPTHKTRP--NYTSP 79


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,134,480
Number of Sequences: 59808
Number of extensions: 393180
Number of successful extensions: 1112
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1025
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1101
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1901817086
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -