SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_47865| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.41 
SB_26790| Best HMM Match : DUF262 (HMM E-Value=4.8)                    32   0.41 
SB_22532| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.41 
SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.54 
SB_32713| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.95 
SB_50063| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.2  
SB_51719| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_51583| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.5)                 29   3.8  
SB_48236| Best HMM Match : DNA_pol_B_2 (HMM E-Value=8.6e-09)           29   5.1  
SB_59618| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.7  
SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0)                    28   8.9  
SB_9093| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.9  
SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   8.9  

>SB_47865| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1273

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 12/34 (35%), Positives = 22/34 (64%)
 Frame = +1

Query: 502 HHDFLSLIIDDMVYTRDKSSLDFVMQQLKTMKVL 603
           H D++S++IDD  Y  +   ++ V+ ++ T KVL
Sbjct: 435 HGDYMSIVIDDKQYCNNSHGVNIVVLEMLTFKVL 468


>SB_26790| Best HMM Match : DUF262 (HMM E-Value=4.8)
          Length = 525

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 29/118 (24%), Positives = 59/118 (50%), Gaps = 4/118 (3%)
 Frame = +2

Query: 179 ADAAFFSLQRQLFVVFVSSHRPFASSKSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQ 358
           A+AAFFSL+  +F+  +     +  SKS  ++   S+   +      L+  ++ Q + ++
Sbjct: 381 AEAAFFSLRMDVFLQTIL----YLGSKS--ISHSYSALTKFHKILKSLIPTEEAQIHALK 434

Query: 359 QLIEWAINASPDMDL----QQFRIEFMDKTTELNLRSCQPKSFTYTFTTIWDTMTFSV 520
            L E+  N SP M +    +  R++ ++ T  +N   C+  S  +T +  W+ MT ++
Sbjct: 435 TLKEFWCN-SPQMTIILVDKLIRMQVVECTAVINWLLCKDMSQDFTKSYTWELMTTTI 491


>SB_22532| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 698

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 18/55 (32%), Positives = 22/55 (40%)
 Frame = -1

Query: 468 LGWHERKLSSVVLSINSMRNCCKSMSGDALMAHSINCCTSYF*MSLYFIKHAKWY 304
           LGWH RK  +             S S     AH   CC+  F  S  F+KH  W+
Sbjct: 75  LGWHGRKTPNK--HETQEVKATSSPSTTEPFAHQCTCCSKKFNNSSRFLKHMTWH 127


>SB_3743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 365

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 3/42 (7%)
 Frame = +2

Query: 251 SSKSAHLTKLLSSQAT---YLYHFACLMKYKDIQKYEVQQLI 367
           S+KS +  KLL ++ +   YLYHF   +K K+ +++E +Q+I
Sbjct: 306 SAKSGYNVKLLFTKLSKDLYLYHFTRYLKMKEERRHEGEQII 347


>SB_32713| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 174

 Score = 31.1 bits (67), Expect = 0.95
 Identities = 14/52 (26%), Positives = 27/52 (51%)
 Frame = +3

Query: 519 SHHRRYGVYARQKQSRFCHAAVENDEGAILQRIFHTTVRHVPRSLYERQRFP 674
           S +RR+G  + Q+ +R   +  +  E +I +   H T   +P  +  ++RFP
Sbjct: 25  SSYRRHGTVSLQEMTRRVKSETKGMEWSIQKYTLHNTTDAIPSPVNHKRRFP 76


>SB_50063| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 307

 Score = 29.9 bits (64), Expect = 2.2
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 4/72 (5%)
 Frame = +2

Query: 320 LMKYKDIQKYEVQQL--IEWAINASPDMD--LQQFRIEFMDKTTELNLRSCQPKSFTYTF 487
           L+ YKD + YE  +L  IE + +  P+++    Q R + +     L       K  + T 
Sbjct: 170 LVNYKDTRDYETSELKRIELSHDVYPNLEQFKNQSRTKLLPLQQTLKNLDTTDKQSSATA 229

Query: 488 TTIWDTMTFSVS 523
             I+D M+F+VS
Sbjct: 230 NDIYDIMSFAVS 241


>SB_51719| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1296

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 9/21 (42%), Positives = 16/21 (76%)
 Frame = +1

Query: 457 VPAQEFYLHVYHHMGHHDFLS 519
           +PA E+ L++YH  GH D+++
Sbjct: 298 LPAPEYLLYLYHAKGHFDYIN 318


>SB_51583| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.5)
          Length = 55

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 2/25 (8%)
 Frame = +3

Query: 399 TCNS--FA*NLWTKPQNSICVRASP 467
           TC    F  ++W+ PQN+ICVR  P
Sbjct: 17  TCKKGLFKMSVWSNPQNNICVRECP 41


>SB_48236| Best HMM Match : DNA_pol_B_2 (HMM E-Value=8.6e-09)
          Length = 1396

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 9/21 (42%), Positives = 16/21 (76%)
 Frame = +1

Query: 457 VPAQEFYLHVYHHMGHHDFLS 519
           +PA E+ L++YH  GH D+++
Sbjct: 366 LPAPEYRLYLYHAKGHFDYIN 386


>SB_59618| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 416

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +3

Query: 573 HAAVENDEGAILQRIFHTTVRH 638
           HA ++ D+G I  + F TTVRH
Sbjct: 326 HAKIKRDKGLISNKEFKTTVRH 347


>SB_52656| Best HMM Match : ABC_tran (HMM E-Value=0)
          Length = 1321

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 159 LLVAMIPLTPLFSRYKDSYLLYSFRLIDLLRALNR 263
           LLV  IP+T LF  Y  +Y L + R +  L A+NR
Sbjct: 576 LLVGAIPMTVLFG-YIRNYYLRTSREVKRLEAINR 609


>SB_9093| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 122

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 18/67 (26%), Positives = 32/67 (47%)
 Frame = +2

Query: 194 FSLQRQLFVVFVSSHRPFASSKSAHLTKLLSSQATYLYHFACLMKYKDIQKYEVQQLIEW 373
           FSL + L    + S + F+  K +  T L SSQA  L+  +     +  Q ++  +L   
Sbjct: 53  FSLHKPLVFTSLQSSQAFSLHKPSVFTSLQSSQAFSLHKPSVFTSLQSSQAFKEWRLCFE 112

Query: 374 AINASPD 394
           A+  +P+
Sbjct: 113 AMEINPE 119


>SB_8500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3408

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 15/34 (44%), Positives = 17/34 (50%)
 Frame = -3

Query: 112  YVSADTDADEPIIYFENITECLTDDQCDKFTYFA 11
            YV+   D D  I YF N  E  + DQ  KF  FA
Sbjct: 3294 YVAGIKDTDLHIEYFWNALENFSQDQLRKFIKFA 3327


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,859,141
Number of Sequences: 59808
Number of extensions: 483816
Number of successful extensions: 1202
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1113
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1199
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1937927537
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -