SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_10439| Best HMM Match : Metallothio_7 (HMM E-Value=3.6)             34   0.13 
SB_19175| Best HMM Match : 7tm_1 (HMM E-Value=4.2e-05)                 32   0.41 
SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06)                   31   0.71 
SB_9009| Best HMM Match : Peptidase_C1 (HMM E-Value=5.9e-40)           31   0.94 
SB_49461| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.6  
SB_55161| Best HMM Match : Kunitz_BPTI (HMM E-Value=6.3)               29   3.8  
SB_17743| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_15426| Best HMM Match : Kunitz_BPTI (HMM E-Value=4.6)               29   3.8  
SB_2503| Best HMM Match : Kunitz_BPTI (HMM E-Value=4.6)                29   3.8  
SB_49235| Best HMM Match : Peptidase_C1 (HMM E-Value=7.5e-07)          29   5.0  
SB_51097| Best HMM Match : Peptidase_C1 (HMM E-Value=9.3e-07)          29   5.0  
SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_40986| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_54597| Best HMM Match : zf-B_box (HMM E-Value=4e-17)                28   6.6  
SB_17477| Best HMM Match : PSI (HMM E-Value=1.7)                       28   8.8  
SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0)               28   8.8  

>SB_10439| Best HMM Match : Metallothio_7 (HMM E-Value=3.6)
          Length = 288

 Score = 33.9 bits (74), Expect = 0.13
 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVGRLC 150
           CAR  T N CACC+ MN   RC T+ G  C
Sbjct: 244 CARCVTMNGCACCVTMNGYPRCVTMNGCAC 273



 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 1/30 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVGRLC 150
           CAR  T N CA C+ MN   RC T+ G  C
Sbjct: 226 CARCVTMNGCARCVTMNGCARCVTMNGCAC 255


>SB_19175| Best HMM Match : 7tm_1 (HMM E-Value=4.2e-05)
          Length = 431

 Score = 32.3 bits (70), Expect = 0.41
 Identities = 25/84 (29%), Positives = 42/84 (50%), Gaps = 5/84 (5%)
 Frame = +1

Query: 235 QRHERKIYNVIDFCKGLEIAHDDILDCNWDSDQVYH--LNEIIFHKQKSKRDLNSLGALF 408
           QR ER +   + F   L +    + +  W +D+  H  L++I F  + +   +N +  LF
Sbjct: 286 QRRERDLAKTLFFVTALSVLAW-VPNAVWTADKGDHSILDKIAFCGRFANSFINPIVYLF 344

Query: 409 ATK---QGLLKILMRLNFDNKSNA 471
             K   +GLLKI  R + D +SN+
Sbjct: 345 QMKDFREGLLKICRRTDLDGRSNS 368


>SB_18951| Best HMM Match : EGF (HMM E-Value=2.1e-06)
          Length = 1223

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +1

Query: 262 VIDFCKGLEIAHDDILDCNWDSDQVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKILM 441
           V+ FC G   +H D L C W S + Y+   + F  +K+K D   L  +F T +    ++ 
Sbjct: 702 VVKFCNGKSSSHVDPLQCFWLS-RDYYDGVVDFFLKKTKED--HLNVVFLTPRTRAMVIC 758

Query: 442 R 444
           R
Sbjct: 759 R 759


>SB_9009| Best HMM Match : Peptidase_C1 (HMM E-Value=5.9e-40)
          Length = 251

 Score = 31.1 bits (67), Expect = 0.94
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = +1

Query: 274 CKGLEIAHDDILDCNWDSDQVYHLN 348
           C+ L +A   +LDC W +  VYH N
Sbjct: 43  CELLNLAEQQLLDCTWSTPGVYHGN 67


>SB_49461| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 257

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +1

Query: 283 LEIAHDDILDCNWDSDQVYHLN 348
           L +A   +LDC W + +VYH N
Sbjct: 40  LNLAEQQLLDCTWSTPEVYHGN 61


>SB_55161| Best HMM Match : Kunitz_BPTI (HMM E-Value=6.3)
          Length = 260

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 1/30 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVGRLC 150
           CAR  T N CA C+ MN   RC T+ G  C
Sbjct: 216 CARCVTMNGCARCVTMNGYPRCVTMNGCTC 245


>SB_17743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 260

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 1/30 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVGRLC 150
           CAR  T N CA C+ MN   RC T+ G  C
Sbjct: 216 CARCVTMNGCARCVTMNGCPRCVTMNGCTC 245



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -3

Query: 254 ILRSCRCARICT*NCACCI*MNPI*RCATIVG 159
           + R  RC  +    CACC+ MN   RC T+ G
Sbjct: 168 VTRKKRCVTMN--GCACCVTMNGCSRCVTMNG 197



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVG 159
           C+R  T N CA C+ MN   RC TI G
Sbjct: 189 CSRCVTMNGCARCVTMNGCARCVTIYG 215


>SB_15426| Best HMM Match : Kunitz_BPTI (HMM E-Value=4.6)
          Length = 224

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVG 159
           CAR  T N CA C+ MN   RC TI G
Sbjct: 189 CARCVTMNGCARCVTMNGCARCVTIYG 215



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -3

Query: 254 ILRSCRCARICT*NCACCI*MNPI*RCATIVG 159
           + R  RC  +    CACC+ MN   RC T+ G
Sbjct: 168 VTRGKRCVTMN--GCACCVTMNGCARCVTMNG 197


>SB_2503| Best HMM Match : Kunitz_BPTI (HMM E-Value=4.6)
          Length = 224

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVG 159
           CAR  T N CA C+ MN   RC TI G
Sbjct: 189 CARCVTMNGCARCVTMNGCARCVTIYG 215



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -3

Query: 254 ILRSCRCARICT*NCACCI*MNPI*RCATIVG 159
           + R  RC  +    CACC+ MN   RC T+ G
Sbjct: 168 VTRGKRCVTMN--GCACCVTMNGCARCVTMNG 197


>SB_49235| Best HMM Match : Peptidase_C1 (HMM E-Value=7.5e-07)
          Length = 122

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +1

Query: 283 LEIAHDDILDCNWDSDQVYHLN 348
           L +A   +LDC W +  VYH N
Sbjct: 5   LNLAEQQLLDCTWSTPGVYHGN 26


>SB_51097| Best HMM Match : Peptidase_C1 (HMM E-Value=9.3e-07)
          Length = 122

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +1

Query: 283 LEIAHDDILDCNWDSDQVYHLN 348
           L +A   +LDC W +  VYH N
Sbjct: 5   LNLAEQQLLDCTWSTPGVYHGN 26


>SB_42540| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1471

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +1

Query: 283 LEIAHDDILDCNWDSDQVYHLN 348
           L +A   +LDC W +  VYH N
Sbjct: 189 LNLAEQQLLDCTWSTPGVYHGN 210


>SB_40986| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 118

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +1

Query: 283 LEIAHDDILDCNWDSDQVYHLN 348
           L +A   +LDC W +  VYH N
Sbjct: 65  LNLAEQQLLDCTWSTPGVYHGN 86


>SB_54597| Best HMM Match : zf-B_box (HMM E-Value=4e-17)
          Length = 755

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVG 159
           CAR  T N CA C+ MN   RC TI G
Sbjct: 702 CARCVTMNGCARCVTMNGCARCVTING 728


>SB_17477| Best HMM Match : PSI (HMM E-Value=1.7)
          Length = 206

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = -3

Query: 254 ILRSCRCARICT*NCACCI*MNPI*RCATIVG 159
           + R  RC  +    CACC+ MN   RC T+ G
Sbjct: 96  VTRGKRCVTMN--GCACCVTMNGCSRCVTMNG 125



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVG 159
           C+R  T N CA C+ MN   RC TI G
Sbjct: 117 CSRCVTMNGCARCVTMNGCARCVTIYG 143



 Score = 27.9 bits (59), Expect = 8.8
 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 1/27 (3%)
 Frame = -3

Query: 236 CARICT*N-CACCI*MNPI*RCATIVG 159
           CAR  T N C CC+ MN    C TI G
Sbjct: 171 CARCVTMNGCLCCVTMNGCTCCVTING 197


>SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0)
          Length = 2064

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 16/67 (23%), Positives = 28/67 (41%)
 Frame = +1

Query: 307 LDCNWDSDQVYHLNEIIFHKQKSKRDLNSLGALFATKQGLLKILMRLNFDNKSNALLHLQ 486
           L+ +WD  +  H N +I H     R     GA + T       ++  N D  +N  + +Q
Sbjct: 655 LEISWDPPRPEHRNGLITHFTIKYRAKGQRGAKYLTVDATKTSVVLHNLDKFTNYFIWVQ 714

Query: 487 TEGERDD 507
              ++ D
Sbjct: 715 ASTKQGD 721


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,001,277
Number of Sequences: 59808
Number of extensions: 358854
Number of successful extensions: 1025
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 937
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1018
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1913853903
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -