SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5)                       31   1.3  
SB_44509| Best HMM Match : EMI (HMM E-Value=4.2)                       30   1.7  
SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6)                    30   1.7  
SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0)                       29   3.9  
SB_31237| Best HMM Match : Cathelicidins (HMM E-Value=0.58)            29   3.9  
SB_47960| Best HMM Match : Extensin_2 (HMM E-Value=0.54)               29   5.1  

>SB_25877| Best HMM Match : TP1 (HMM E-Value=8.5)
          Length = 139

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = +3

Query: 309 MPVMQDERKMSKRKKKVINNNKYILFNSWYTKIK 410
           +PV    +++   + K  NN KY L   WY+K++
Sbjct: 7   LPVQNQAKRLRTWRSKTRNNTKYKLICIWYSKVR 40


>SB_44509| Best HMM Match : EMI (HMM E-Value=4.2)
          Length = 782

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +2

Query: 17  DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLQKLRPCAK 193
           D+ S RK  C   +   +++ I+++  Q+  R  +K+ K+  + TC       +LR CA 
Sbjct: 63  DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 122

Query: 194 MKS 202
           ++S
Sbjct: 123 VRS 125


>SB_12493| Best HMM Match : RrnaAD (HMM E-Value=4.6)
          Length = 984

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +2

Query: 17   DKCSKRK-VCLHHKRIARLLGIKKIYHQEYKRVVSKVYKNQTW*TCRSNNLLQKLRPCAK 193
            D+ S RK  C   +   +++ I+++  Q+  R  +K+ K+  + TC       +LR CA 
Sbjct: 830  DRYSTRKGACAVVQSSQKMIDIRRVRRQKSMRSCAKLSKDNRYSTCTPAEEYAQLRVCAV 889

Query: 194  MKS 202
            ++S
Sbjct: 890  VRS 892


>SB_50241| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 131

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%)
 Frame = +3

Query: 273 LEKKNINYILNVMPVMQDERKMSKRKKKVINNNKY---ILFNSWYTKIKQPEWPSSPAMW 443
           +E K + Y      V +DE K+  RK+ +    +Y   ILFN++    ++ +W  S + W
Sbjct: 26  IEAKTMKYKYGCSDVPRDE-KLDLRKRSLYYLERYFYFILFNTYLNMERRSKWDRSFSQW 84


>SB_38410| Best HMM Match : 7tm_1 (HMM E-Value=0)
          Length = 368

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 13/51 (25%), Positives = 24/51 (47%)
 Frame = -2

Query: 395 PTVKQNVFIVVNHLLLAFGHFAFVLHDRHYVEDIVNVLFFQEIYNSNSWSM 243
           P    N+ +++ +L  A   + +  HDR + E   N+LF   I +   W +
Sbjct: 313 PREVHNILLLMGYLNSALNPYMYSFHDRQFKEAFKNILF--NIQSHKVWDL 361


>SB_31237| Best HMM Match : Cathelicidins (HMM E-Value=0.58)
          Length = 562

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 11/29 (37%), Positives = 19/29 (65%)
 Frame = +3

Query: 249 PAIAIVNFLEKKNINYILNVMPVMQDERK 335
           P  ++ +  EK N N ILN +P+ Q+++K
Sbjct: 239 PQASVRSTYEKDNSNTILNTLPIKQEQKK 267


>SB_47960| Best HMM Match : Extensin_2 (HMM E-Value=0.54)
          Length = 710

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = -1

Query: 222 RFQFIQQLFIFAHGRSFCRRLLLRHVYH 139
           RF    Q  I+AH  SF +R+LLR + H
Sbjct: 22  RFPRNPQKLIYAHQNSFKKRILLRRIEH 49


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,197,444
Number of Sequences: 59808
Number of extensions: 508887
Number of successful extensions: 1357
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1243
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1356
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1949964354
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -