SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.084
SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.45 
SB_45203| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.1  
SB_35701| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.2  
SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.2  
SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.5  
SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.3  
SB_51563| Best HMM Match : C1_4 (HMM E-Value=2)                        28   9.6  
SB_51027| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.6  

>SB_41668| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 588

 Score = 34.7 bits (76), Expect = 0.084
 Identities = 22/75 (29%), Positives = 39/75 (52%)
 Frame = -1

Query: 689 TLIFSQISTKSLHSPWTSTWITNSSKSAY*LVLARIPQSRN*STMPSHAVSHNTNSIRIY 510
           T + S  ++  L+   T+T++++SS S    ++ RIP SR   T  S  +     + R+ 
Sbjct: 305 TYLSSSSNSTFLYYGKTNTYLSSSSNSTSFTMVRRIPTSRVRQTRLSFTMVRRIPTSRVR 364

Query: 509 PLQKAFKIKSYNSTF 465
             + +F + S NSTF
Sbjct: 365 QTRLSFTMSSSNSTF 379


>SB_32754| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 5659

 Score = 32.3 bits (70), Expect = 0.45
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 2/68 (2%)
 Frame = -1

Query: 398  LTPKSHDESSPSILTPRGEVSGPTTITPCSAAYLWKPDLVM-KFCSLQVDQTNNIEVVIS 222
            +TPKS  E  P+ +TP   V+  TT+TP S      P   M    +L+ ++T   E+ ++
Sbjct: 2571 ITPKS-TELPPTTMTPESTVTPATTMTPESTV---APGTTMAPESTLEPEKTMTPEITVT 2626

Query: 221  HHP-LLPE 201
              P LLPE
Sbjct: 2627 PEPTLLPE 2634


>SB_45203| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 668

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = +2

Query: 56  NFSGAHQKSNMDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPL 235
           NF     K+   SL L+  +K+F    + Y+ A+     K+N  +  PPQ +G   +LP 
Sbjct: 224 NFLPPQVKAQFHSL-LDKYDKVFDPNIQGYNGAADPFGAKVNMGLVEPPQRKG---RLP- 278

Query: 236 LYYLSGQLV 262
             Y  G+LV
Sbjct: 279 -QYARGKLV 286


>SB_35701| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 540

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = -1

Query: 290 PDLVMKFCSLQVDQTNNIEVVISHHPLLPEGGDR*KNSFCILI 162
           PD+  KFC     + N +E++I  H + PEG +   +  CI I
Sbjct: 384 PDITEKFC-----KDNGLELIIRSHEVKPEGYEVMHDGKCITI 421


>SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1113

 Score = 29.1 bits (62), Expect = 4.2
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%)
 Frame = +1

Query: 364  DGDDSSWDFGVSAGFYLDATNEPWNN--NYRMGSYLNVEL 477
            D D  +W    + G +  AT E  NN  +YR+G  + VEL
Sbjct: 1057 DNDRYNWQRPFTKGKFASATGEKINNPRDYRVGDIIGVEL 1096


>SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 565

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 2/35 (5%)
 Frame = +2

Query: 524 NWYYGTQHGRAWCFSFYSEESW--PVQVSKRFCCY 622
           NWY+ T+    WC    ++ +W  P++     CCY
Sbjct: 525 NWYHPTKTQANWCHPTKTQANWNHPIKTHAN-CCY 558


>SB_55598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 668

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -1

Query: 707 IPFRPFTLIFSQISTKSLHSPWTSTWITNSSKS 609
           + FRP  +I+S     SLH P  S W+  + +S
Sbjct: 148 VAFRPRRIIYSPPGAISLHIPGNSHWLYETPRS 180


>SB_51563| Best HMM Match : C1_4 (HMM E-Value=2)
          Length = 322

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +2

Query: 185 SIYLPPQAEGGDVKLPLLYYLSGQLVVNKTSSL 283
           S Y+ P + G  VK+ LLY  +G+L V + S+L
Sbjct: 53  SPYMSPFSPGAMVKVGLLYNRNGELKVKRGSTL 85


>SB_51027| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 306

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 12/26 (46%), Positives = 15/26 (57%)
 Frame = +3

Query: 672 LGEDKSKWAEWDATELVKKYNGPPLT 749
           +GE K+ +A W   ELVK   GP  T
Sbjct: 276 IGELKNMFARWGIPELVKSDGGPQFT 301


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,164,039
Number of Sequences: 59808
Number of extensions: 543178
Number of successful extensions: 1254
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1131
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1250
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2095976575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -