SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120021.Seq
         (683 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.66 
SB_30920| Best HMM Match : DUP (HMM E-Value=4.6)                       31   0.87 
SB_53066| Best HMM Match : RR_TM4-6 (HMM E-Value=0.68)                 31   0.87 
SB_41087| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   0.87 
SB_35476| Best HMM Match : zf-C2H2 (HMM E-Value=4.3)                   31   0.87 
SB_25901| Best HMM Match : DUP (HMM E-Value=4.5)                       31   0.87 
SB_3566| Best HMM Match : zf-C2H2 (HMM E-Value=4.3)                    31   0.87 
SB_16511| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0)                29   4.6  
SB_38804| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.6  
SB_14545| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.1  
SB_51105| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.1  
SB_41086| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.1  

>SB_21034| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1101

 Score = 31.5 bits (68), Expect = 0.66
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = -1

Query: 467 SREFDTEALVNFENDNCNVRIAKTFGASKRKNTTRSDDYESNKQP 333
           S E + +ALV   +DN N +IAK  G+S+  +T    +Y   K P
Sbjct: 183 SVEREIQALVGKSDDNTNKKIAKMDGSSQIPDTLLPSEYHIVKNP 227


>SB_30920| Best HMM Match : DUP (HMM E-Value=4.6)
          Length = 404

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = -1

Query: 410 RIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIII 231
           R A+     KR +   SD Y S    D+D+     S +E EA+  L     VN+    I+
Sbjct: 153 RTARLARPCKRPSLVESDQY-STSDEDFDVTKQPVSFSEDEASVALMTTTSVNVSHLTIL 211

Query: 230 FLKIT 216
           FL I+
Sbjct: 212 FLLIS 216


>SB_53066| Best HMM Match : RR_TM4-6 (HMM E-Value=0.68)
          Length = 411

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = -1

Query: 410 RIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIII 231
           R A+     KR +   SD Y S    D+D+     S +E EA+  L     VN+    I+
Sbjct: 249 RTARLARPCKRPSLVESDQY-STSDEDFDVTKQPVSFSEDEASVALMTTTSVNVSHLTIL 307

Query: 230 FLKIT 216
           FL I+
Sbjct: 308 FLLIS 312


>SB_41087| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 491

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = -1

Query: 410 RIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIII 231
           R A+     KR +   SD Y S    D+D+     S +E EA+  L     VN+    I+
Sbjct: 94  RTARLARPCKRPSLVESDQY-STSDEDFDVTKQPVSFSEDEASVALMTTTSVNVSHLTIL 152

Query: 230 FLKIT 216
           FL I+
Sbjct: 153 FLLIS 157


>SB_35476| Best HMM Match : zf-C2H2 (HMM E-Value=4.3)
          Length = 243

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = -1

Query: 410 RIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIII 231
           R A+     KR +   SD Y S    D+D+     S +E EA+  L     VN+    I+
Sbjct: 81  RTARLARPCKRPSLVESDQY-STSDEDFDVTKQPVSFSEDEASVALMTTTSVNVSHLTIL 139

Query: 230 FLKIT 216
           FL I+
Sbjct: 140 FLLIS 144


>SB_25901| Best HMM Match : DUP (HMM E-Value=4.5)
          Length = 186

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = -1

Query: 410 RIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIII 231
           R A+     KR +   SD Y S    D+D+     S +E EA+  L     VN+    I+
Sbjct: 24  RTARLARPCKRPSLVESDQY-STSDEDFDVTKQPVSFSEDEASVALMTTTSVNVSHLTIL 82

Query: 230 FLKIT 216
           FL I+
Sbjct: 83  FLLIS 87


>SB_3566| Best HMM Match : zf-C2H2 (HMM E-Value=4.3)
          Length = 323

 Score = 31.1 bits (67), Expect = 0.87
 Identities = 21/65 (32%), Positives = 30/65 (46%)
 Frame = -1

Query: 410 RIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIII 231
           R A+     KR +   SD Y S    D+D+     S +E EA+  L     VN+    I+
Sbjct: 82  RTARLARPCKRPSLVESDQY-STSDEDFDVTKQPVSFSEDEASVALMTTTSVNVSHLTIL 140

Query: 230 FLKIT 216
           FL I+
Sbjct: 141 FLLIS 145


>SB_16511| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 405

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 24/85 (28%), Positives = 43/85 (50%), Gaps = 2/85 (2%)
 Frame = +3

Query: 429 FKVY*SLGVKLAA*HFNDRRSVDGAQHTPSFSVNKMGSPGMLVSLVSVTTNSILLVKLVT 608
           F+   SL    A  +F    S+  +  TPS  V  + +  + +SL+SVTT +  +   ++
Sbjct: 31  FRYVMSLTYSGALGNFAFNSSLCNSLPTPSQLVQGLVTLPLALSLLSVTTKNQNITSNIS 90

Query: 609 S--GWNLLCIKANVLNTTAAICRVS 677
           S     +L I   +L  T+++CR+S
Sbjct: 91  SCNSTPVLNISTVILGGTSSLCRIS 115


>SB_45869| Best HMM Match : ANF_receptor (HMM E-Value=0)
          Length = 939

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 19/53 (35%), Positives = 29/53 (54%)
 Frame = -1

Query: 392 GASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICII 234
           G SKRK+ TR  ++  N + DY +  S   +  +E   + T+L IV   +CII
Sbjct: 18  GGSKRKHHTRLKEHTLNSKQDYKLCNSSLVMKSLE---WRTVLFIV---LCII 64


>SB_38804| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 450

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 13/29 (44%), Positives = 18/29 (62%)
 Frame = -3

Query: 204 YCKSLTDHSLFTNKLRSTMSTKTSNLLLS 118
           YCK   D +LF +K+  T  +KTS +L S
Sbjct: 188 YCKVEKDLNLFCSKILPTRDSKTSKILTS 216


>SB_14545| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 244

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = +3

Query: 492 VDGAQHTPSFSVNKMGSPGMLVSLVSVTTNSILLVKLVTS--GWNLLCIK 635
           +DG  HTP+  +N     G +  L S+      L+  +TS   W+L+ +K
Sbjct: 55  IDGTTHTPNVCINLTDDDGFVPELPSLPGMKSSLLHSMTSYPVWSLISLK 104


>SB_51105| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1280

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 14/35 (40%), Positives = 18/35 (51%)
 Frame = -3

Query: 204 YCKSLTDHSLFTNKLRSTMSTKTSNLLLSKFKFTI 100
           YC+  T H LF+N  R+  +    NL LS  K  I
Sbjct: 430 YCRGNTPHELFSNWKRTLQALHECNLRLSASKTII 464


>SB_41086| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 143

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 19/61 (31%), Positives = 27/61 (44%)
 Frame = -1

Query: 410 RIAKTFGASKRKNTTRSDDYESNKQPDYDMDLSDFSITEVEATQYLTLLLIVNMPICIII 231
           R A+     KR +   SD Y S    D+D+     S +E EA+  L     VN+    I+
Sbjct: 42  RTARLARPCKRPSLVESDQY-STSDEDFDVTKQPVSFSEDEASVALMTTTSVNVSHLTIL 100

Query: 230 F 228
           F
Sbjct: 101 F 101


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,016,224
Number of Sequences: 59808
Number of extensions: 349877
Number of successful extensions: 918
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 861
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 918
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1769412099
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -