SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)             29   3.8  
SB_13177| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.8  
SB_6636| Best HMM Match : COX7C (HMM E-Value=1.8)                      29   3.8  
SB_10437| Best HMM Match : FMN_bind (HMM E-Value=9.8)                  29   5.1  
SB_27096| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   6.7  
SB_10597| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=8.2e-34)       28   8.9  
SB_460| Best HMM Match : YGGT (HMM E-Value=2.7)                        28   8.9  

>SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0)
          Length = 6725

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 12/34 (35%), Positives = 17/34 (50%)
 Frame = +1

Query: 169  NTSISIIVRNLGNCPNNKDRVKCCDLNYGASRRD 270
            NT    + R + +CP  +DRV  C   Y  S R+
Sbjct: 1649 NTRPETVTRGIPDCPKIRDRVTDCQREYQLSERN 1682


>SB_13177| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 249

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 2/41 (4%)
 Frame = +3

Query: 186 YSQEFGQLSKQQRSSKVLRSQLRGIP--PGHVMCPPREITK 302
           + +EF  +S+ +R++  +  Q+RG+P  PG  M    +I K
Sbjct: 110 FDEEFEAMSEDERNADKIMKQMRGVPGMPGMEMYSREDIAK 150


>SB_6636| Best HMM Match : COX7C (HMM E-Value=1.8)
          Length = 237

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 10/37 (27%), Positives = 24/37 (64%)
 Frame = +2

Query: 362 INCAPIRSRRRICEFTRKRKQPATCSRRVSITFIGLG 472
           ++  P RS++++   T   ++P+  +++ +ITF+G G
Sbjct: 63  LDSPPARSKKQLLTTTSPERRPSPKTKKSTITFLGFG 99


>SB_10437| Best HMM Match : FMN_bind (HMM E-Value=9.8)
          Length = 177

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = +2

Query: 302 KGFSLRKVG*KPQQVQTIQRINCAPIRSRRRI 397
           KG  L+++  K   V+ ++R+NC P+ SR  +
Sbjct: 72  KGLLLQRIADKRLAVERLKRLNCPPLPSREPV 103


>SB_27096| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 949

 Score = 28.3 bits (60), Expect = 6.7
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = -2

Query: 326 PLCVMKNLFGNLTRRAHDMSRRDAP*LRSQHFTRSL 219
           PLCV   +FG +  R + M R      R  H  R+L
Sbjct: 420 PLCVSATVFGTMNARVYGMGRMYFAAAREGHLPRAL 455


>SB_10597| Best HMM Match : Gal-3-0_sulfotr (HMM E-Value=8.2e-34)
          Length = 728

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -3

Query: 409 RKLADAPPASDWRAINSLYRLYLLGFLTHF 320
           RK+A+A P  DWR I   Y+ +  G++T F
Sbjct: 15  RKMANAKPVDDWRFIFKNYKKH--GYVTLF 42


>SB_460| Best HMM Match : YGGT (HMM E-Value=2.7)
          Length = 252

 Score = 27.9 bits (59), Expect = 8.9
 Identities = 13/30 (43%), Positives = 17/30 (56%)
 Frame = -3

Query: 418 TFSRKLADAPPASDWRAINSLYRLYLLGFL 329
           T S   + +PP +DW AI+S  R  L G L
Sbjct: 194 TISTYNSGSPPGTDWTAISSWIRTMLYGAL 223


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,685,426
Number of Sequences: 59808
Number of extensions: 408625
Number of successful extensions: 1013
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 944
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1013
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1937927537
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -