SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_39662| Best HMM Match : BIR (HMM E-Value=1.2e-19)                   48   7e-06
SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30)                   42   6e-04
SB_28819| Best HMM Match : BIR (HMM E-Value=2.6e-32)                   36   0.051
SB_31644| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.4  
SB_8042| Best HMM Match : DUF803 (HMM E-Value=0)                       29   4.4  
SB_1636| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.8  
SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09)                28   7.7  

>SB_39662| Best HMM Match : BIR (HMM E-Value=1.2e-19)
          Length = 314

 Score = 48.4 bits (110), Expect = 7e-06
 Identities = 19/57 (33%), Positives = 28/57 (49%)
 Frame = +2

Query: 509 NFWPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           NFWPA     +  +A AG  +TGR D   CF C   ++ W +++   + H    P C
Sbjct: 143 NFWPATSSANVFELARAGFVFTGRDDVVECFKCKGTLKQWKVDDRPIESHREFYPDC 199


>SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30)
          Length = 514

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 16/59 (27%), Positives = 27/59 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVL 691
           WP +       ++ AG +Y G  D   C+ C   +R+W  ++  W  H   +P C  V+
Sbjct: 141 WPESSPVRPWELSSAGFYYLGDQDSVKCYKCGVALRNWEPDDLPWVEHEKWSPHCPLVI 199



 Score = 30.3 bits (65), Expect = 1.9
 Identities = 13/39 (33%), Positives = 17/39 (43%)
 Frame = +3

Query: 255 FKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           F Y    D V C  C   ++NW  D+     H   SP+C
Sbjct: 157 FYYLGDQDSVKCYKCGVALRNWEPDDLPWVEHEKWSPHC 195


>SB_28819| Best HMM Match : BIR (HMM E-Value=2.6e-32)
          Length = 141

 Score = 35.5 bits (78), Expect = 0.051
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 3/50 (6%)
 Frame = +2

Query: 548 IAEAGLFYTGRGDE---TVCFFCDCCVRDWHINEDAWQRHATENPQCYFV 688
           +A AG ++    D+     CF C   +  W   +D WQ H   +P+C FV
Sbjct: 37  MAAAGFYHCETDDDPDVARCFVCFKELDGWEPEDDPWQEHKKHSPKCEFV 86


>SB_31644| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 935

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = -3

Query: 520 RPKITNVSIRDCKLDMHL-YTHLGLPSFTSTALMVMLSPNDSCSAILLAYAQYGDKVTCA 344
           R K  + S  D KLD       +    + +TA  V  SP ++CS      +QY +K+T  
Sbjct: 517 RGKERSTSCTDVKLDFAADMPRMPCAVYENTARRVTGSPGNNCSLAAKPSSQYTEKLTDR 576

Query: 343 YSIHSSSDQ 317
            S+ +  D+
Sbjct: 577 ESLTTRQDK 585


>SB_8042| Best HMM Match : DUF803 (HMM E-Value=0)
          Length = 603

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -2

Query: 344 IFNTLVFGPIFYFCFTILAHNVIVDLIVFK 255
           IFNT +  PI+Y  FT+L   +I   I+FK
Sbjct: 485 IFNTSLVTPIYYVMFTLL--TIIASAILFK 512


>SB_1636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 5.8
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -2

Query: 422 GNVVAKRFVLSNLVGIRAIRRQGYVCIF-NTLVFGPIFYFCFTI 294
           G++V  ++V+   + +RA+R QG++ I  +TL   P +Y  + I
Sbjct: 65  GHLVIGQYVIKGTLLLRAVRYQGHLVITGSTLSIAPCYYGQYVI 108


>SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09)
          Length = 2059

 Score = 28.3 bits (60), Expect = 7.7
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +3

Query: 6   TKTKLGHINVSLNQNDPNVLILTVTL 83
           TKT L  +     +NDPNVL +TV L
Sbjct: 760 TKTALSTVQCCSLENDPNVLAITVIL 785


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,987,880
Number of Sequences: 59808
Number of extensions: 521750
Number of successful extensions: 2182
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1945
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2174
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2227723674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -