SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_3329| Best HMM Match : SNF2_N (HMM E-Value=1.5e-07)                 61   1e-09
SB_42678| Best HMM Match : Helicase_C (HMM E-Value=1.4e-24)            57   1e-08
SB_10642| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   1e-05
SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.)                44   1e-04
SB_46182| Best HMM Match : Helicase_C (HMM E-Value=7.5e-22)            44   2e-04
SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0)                      44   2e-04
SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0)                      44   2e-04
SB_22405| Best HMM Match : SNF2_N (HMM E-Value=0)                      44   2e-04
SB_35930| Best HMM Match : SNF2_N (HMM E-Value=1.3004e-42)             41   0.001
SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21)            41   0.001
SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0)                      38   0.012
SB_621| Best HMM Match : SNF2_N (HMM E-Value=0)                        38   0.012
SB_56356| Best HMM Match : Helicase_C (HMM E-Value=1.3e-21)            36   0.028
SB_47493| Best HMM Match : Helicase_C (HMM E-Value=1.3e-16)            36   0.049
SB_46817| Best HMM Match : No HMM Matches (HMM E-Value=.)              35   0.086
SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.)               33   0.20 
SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41)            32   0.61 
SB_56223| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.4  
SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_54764| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.5  
SB_53475| Best HMM Match : PAN (HMM E-Value=0.00029)                   29   3.2  
SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_58445| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.7  
SB_32630| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-25)                 28   9.9  
SB_6207| Best HMM Match : No HMM Matches (HMM E-Value=.)               28   9.9  
SB_43634| Best HMM Match : Sushi (HMM E-Value=1.2e-16)                 28   9.9  
SB_10205| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.9  

>SB_3329| Best HMM Match : SNF2_N (HMM E-Value=1.5e-07)
          Length = 200

 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/73 (38%), Positives = 45/73 (61%), Gaps = 6/73 (8%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK------MLNKNNDSTNRIKS 167
           L A  RW +TGTPI N+  D++S++ FL+  PF+DP  WK      +   N D+  R+++
Sbjct: 84  LEAERRWVVTGTPIQNRIGDLWSIVRFLRLDPFSDPTWWKISIANGVTRGNEDAQERLQA 143

Query: 168 IIKKIVLKRDKSE 206
           +IK I ++R K +
Sbjct: 144 LIKHISIRRLKDD 156


>SB_42678| Best HMM Match : Helicase_C (HMM E-Value=1.4e-24)
          Length = 1058

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 30/79 (37%), Positives = 43/79 (54%)
 Frame = +1

Query: 532 TSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRIL 711
           TSDDK++LVS + + L +FE   +Q+    +   G + ++ R      FN+       I 
Sbjct: 431 TSDDKVVLVSNYTQTLDLFEKLCRQRRYQHVRLDGSMSIKKRQKIVDRFNDPKGGDF-IF 489

Query: 712 LLSIKCGGVGLNLIGGNTL 768
           +LS K GG GLNLIG N L
Sbjct: 490 MLSSKAGGCGLNLIGANRL 508


>SB_10642| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1023

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 26/81 (32%), Positives = 42/81 (51%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +  ++++  Q    + I E++F  K    L   G  K EDR    + FN A D+ + 
Sbjct: 525 LKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFN-AKDSPYF 583

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GG+GLNL   +T+
Sbjct: 584 VFLLSTRAGGLGLNLQAADTV 604


>SB_248| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2656

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 27/93 (29%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIK 176
           L   +R  +TGTP+ N   +++S++NFL+   F     + M     K     +++K ++K
Sbjct: 714 LQMEHRILLTGTPLQNNVEELFSLLNFLEPSQFPSQGAFLMEFGDLKTESQVDKLKQLLK 773

Query: 177 KIVLKRDKSEISFNI-PK-HTVEYVHVNLMKKK 269
            ++L+R K ++  NI PK  T+  V +  ++KK
Sbjct: 774 PMMLRRLKEDVEKNIAPKEETIIEVELTTVQKK 806


>SB_46182| Best HMM Match : Helicase_C (HMM E-Value=7.5e-22)
          Length = 227

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 22/77 (28%), Positives = 38/77 (49%)
 Frame = +1

Query: 520 DILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQ 699
           + L  +  K+++ S +  +LKI+ ++  + N    + TG  K+ DR      F    D  
Sbjct: 72  ETLLQAKQKVLIFSSYTSHLKIYTDWCDKNNTPYSLLTGSTKIADRESEVANFQK--DDN 129

Query: 700 HRILLLSIKCGGVGLNL 750
             +  +S+K GG GLNL
Sbjct: 130 KLLFFISLKAGGTGLNL 146


>SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0)
          Length = 1918

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ +Q    L + E F        L   G  +VE R +    FN  AD++  
Sbjct: 1434 LKAGKHRVLIFTQMTRMLDVLEKFLNYHGYVYLRLDGSTRVEQRQILMDRFN--ADSRIF 1491

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              +LS + GG+G+NL G +T+
Sbjct: 1492 CFILSTRSGGLGVNLTGADTV 1512


>SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0)
          Length = 1478

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/75 (34%), Positives = 40/75 (53%)
 Frame = +1

Query: 544  KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
            KI++ SQ  + L I +++   +        G +KVEDR      F  A+D +  I LLS 
Sbjct: 1215 KILIFSQMTKMLDILQDYCYLRGYQYSRLDGSMKVEDRREEIDAF--ASDPEKFIFLLST 1272

Query: 724  KCGGVGLNLIGGNTL 768
            + GG+GLNL   +T+
Sbjct: 1273 RAGGLGLNLSAADTV 1287



 Score = 31.9 bits (69), Expect = 0.61
 Identities = 13/33 (39%), Positives = 22/33 (66%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFLQCRPFND 110
            + NR  +TGTP+ N   +++S++NFL    F+D
Sbjct: 967  SANRLLLTGTPLQNNLAELWSLLNFLLPDIFDD 999


>SB_22405| Best HMM Match : SNF2_N (HMM E-Value=0)
          Length = 764

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 27/81 (33%), Positives = 39/81 (48%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           ++ + ++++LVS + + L I +     K    L   G      R      FN A   Q  
Sbjct: 574 IHCTGERVVLVSNYSQTLDILQKLCTVKKYRYLRLDGSTPTAKRQSLVERFN-AKHCQDF 632

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS K GGVGLNLIG + L
Sbjct: 633 VFLLSSKAGGVGLNLIGASRL 653


>SB_35930| Best HMM Match : SNF2_N (HMM E-Value=1.3004e-42)
          Length = 784

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 25/75 (33%), Positives = 34/75 (45%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K++L S   E L I EN+   + +      GQ     R+     FN   D    I L+S 
Sbjct: 457 KVLLFSYSTELLNILENYVIGRGLVFSRLDGQTSPAQRMRVVREFNGNRDIF--ICLVST 514

Query: 724 KCGGVGLNLIGGNTL 768
           K GG+GLN  G N +
Sbjct: 515 KAGGLGLNFTGANVV 529


>SB_30389| Best HMM Match : Helicase_C (HMM E-Value=3.3e-21)
          Length = 380

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = +1

Query: 544 KIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLLSI 723
           K ++VSQ+  +L I E F ++  I  L   G +  E R+     F +      ++ LLS+
Sbjct: 163 KSLVVSQFTSFLDILEYFLERDGIDYLRLDGTMGQEARVKVIDRFRDPDSP--KVFLLSL 220

Query: 724 KCGGVGLNL 750
             GGVGLNL
Sbjct: 221 TAGGVGLNL 229


>SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0)
          Length = 919

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 21/81 (25%), Positives = 36/81 (44%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    + I E +   +    +   G  K+ DR      F N  D    
Sbjct: 607 LKLQGHRVLIYSQMTRMIDILEEYMTFRKHKYMRLDGSSKISDRRDMVADFQNNKDIF-- 664

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           + LLS + GG+G+NL   +T+
Sbjct: 665 VFLLSTRAGGLGINLTAADTV 685



 Score = 31.1 bits (67), Expect = 1.1
 Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPF-NDPRVWKMLNKNNDSTNRIKSIIKKIVLKR 194
           NR  +TGTPI N   +++++++F+    F N     +  +K+ +S    KS+I +  L R
Sbjct: 188 NRLLLTGTPIQNSMAELWALLHFIMPTLFDNHEEFNEWFSKDIESHAENKSLIDQNQLSR 247


>SB_621| Best HMM Match : SNF2_N (HMM E-Value=0)
          Length = 1432

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 22/81 (27%), Positives = 41/81 (50%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +  ++++ SQ V  L I  ++ +Q+        G ++ + R  A   FN A  ++  
Sbjct: 416 LKETGHRVLIFSQMVRMLDILADYLQQRRFLFQRLDGSIRGDLRKQALDHFN-AEGSEDF 474

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 475 CFLLSTRAGGLGINLATADTV 495



 Score = 35.5 bits (78), Expect = 0.049
 Identities = 17/90 (18%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNR-IKSIIKKI---V 185
           +R  +TGTP+ N   +++++++FL    F+    ++ ++   +  ++   S+ K++   +
Sbjct: 253 HRLLVTGTPLQNSLKELWALLHFLMPERFSSWEAFEQIHSTQEQKDKGFASLHKELEPFL 312

Query: 186 LKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           L+R K ++  ++P    + + V +   +K+
Sbjct: 313 LRRVKKDVEKSLPAKVEQILRVEMSSLQKQ 342


>SB_56356| Best HMM Match : Helicase_C (HMM E-Value=1.3e-21)
          Length = 149

 Score = 36.3 bits (80), Expect = 0.028
 Identities = 26/81 (32%), Positives = 38/81 (46%), Gaps = 3/81 (3%)
 Frame = +1

Query: 535 SDDKIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQHR 705
           S  +++L  Q    L I EN   + N+ ++ Y    G      R      FNN  D    
Sbjct: 26  SQHRVLLFCQLKSMLDIVENDLFKTNMPSVTYLRLDGSTPAGSRHSIVHRFNN--DPSID 83

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
           +LLL+   GG+GLNL G +T+
Sbjct: 84  VLLLTTHVGGLGLNLTGADTV 104


>SB_47493| Best HMM Match : Helicase_C (HMM E-Value=1.3e-16)
          Length = 252

 Score = 35.5 bits (78), Expect = 0.049
 Identities = 19/45 (42%), Positives = 27/45 (60%)
 Frame = +1

Query: 634 GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
           G ++ E+R +A   FN   D  + I LLS K GG GLNL+  +T+
Sbjct: 40  GSVRGEERYIAIKNFNEEQD--NFIFLLSTKAGGQGLNLMSADTV 82


>SB_46817| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 470

 Score = 34.7 bits (76), Expect = 0.086
 Identities = 22/86 (25%), Positives = 44/86 (51%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIV 185
           L + NR  +TGTP+ N   ++++++NFL    F+   V +          R+KS ++K +
Sbjct: 200 LRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDVLRPF-----LLRRLKSDVEKRL 254

Query: 186 LKRDKSEISFNIPKHTVEYVHVNLMK 263
           L + ++++   + K    +    LMK
Sbjct: 255 LPKKETKVYTGLTKMQRSWYTKILMK 280


>SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1789

 Score = 33.5 bits (73), Expect = 0.20
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30   ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKN---NDSTNRIKSIIKKIVLKRDK 200
            +TGTP+ N   ++++++ FL    FN+   +     N    D   ++  I+   +L+R K
Sbjct: 812  LTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFDNVAKEDQIKKLHDILGPHMLRRLK 871

Query: 201  SEISFNIPKHTVEYVHVNLMKKKKR 275
            +++   IP  +   V V L   +K+
Sbjct: 872  ADVLKGIPSKSELIVRVELSPMQKK 896



 Score = 32.7 bits (71), Expect = 0.35
 Identities = 22/81 (27%), Positives = 36/81 (44%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L     ++++ SQ    L + E+F +          G +    R  A   FN A  +Q  
Sbjct: 973  LREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFN-APTSQAF 1031

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 1032 CFLLSTRAGGLGINLATADTV 1052


>SB_39230| Best HMM Match : SNF2_N (HMM E-Value=1.40004e-41)
          Length = 1682

 Score = 31.9 bits (69), Expect = 0.61
 Identities = 15/43 (34%), Positives = 23/43 (53%)
 Frame = +1

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            G   V+ R      FN+  +   R+ L+S K GG+G+NL+  N
Sbjct: 1236 GSTSVQLRQRWADIFNDPDNKTARLFLISTKAGGLGINLVAAN 1278


>SB_56223| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1719

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 18/66 (27%), Positives = 36/66 (54%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYLAMH 436
           N+ E+ L+ +L  E  + Y + + +RE ++ L+   +   V   ++ LR+IC HP L   
Sbjct: 686 NKNEQVLFCRLSDEQRQLYEQYLDSREVQSILAGKYK---VFPGLIMLRKICNHPDLTSE 742

Query: 437 GRNLLE 454
             +L++
Sbjct: 743 AGSLIK 748


>SB_10552| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 442

 Score = 30.3 bits (65), Expect = 1.9
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = -3

Query: 484 HIIHFKTVVCFQKISTVHGQIRVAADLPQFQY*P*HVLHLLQSA*RVFAFTRCHSFHIR 308
           HI H       Q+  TVH +  + A L Q +Y   H+ H+L++  +   +TR ++ HI+
Sbjct: 198 HIKHMLRATLKQRKYTVHIKHMLRATLKQRKY-TVHIKHMLRATLKQRKYTRKYTVHIK 255


>SB_54764| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 619

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 10/43 (23%), Positives = 23/43 (53%)
 Frame = +2

Query: 299 SEEAYMKAVAARESENTLSRLQQMQHVLWLILKLRQICCHPYL 427
           S ++ +  +  ++ +N  S +   QH++W  L + ++C   YL
Sbjct: 101 SRDSTVHDIPQQQVDNLFSAVGPFQHIVWFTLSVAKVCLTKYL 143


>SB_53475| Best HMM Match : PAN (HMM E-Value=0.00029)
          Length = 431

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 19/55 (34%), Positives = 22/55 (40%), Gaps = 6/55 (10%)
 Frame = -1

Query: 447 RFLPCMAKYGWQQICLNFSISHNTC------CICCNRLSVFSLSRAATAFIYASS 301
           R  P M  YG +QICLN  I  + C      CIC    +        TA I   S
Sbjct: 141 RLSPAMNHYGTEQICLNGGIVDHACVENELRCICLPEWTGSDCGLGQTAVILTPS 195


>SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 522

 Score = 29.1 bits (62), Expect = 4.3
 Identities = 17/71 (23%), Positives = 29/71 (40%)
 Frame = +3

Query: 66  MYSMINFLQCRPFNDPRVWKMLNKNNDSTNRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
           MY+M    + RPF   + W      +     IK++      K D  E  F   K   +++
Sbjct: 117 MYTMHYNGEKRPFKCDKCWWSFKNPSGLREHIKAVHNSEKFKCDYCEKDFKYAKSLKQHI 176

Query: 246 HVNLMKKKKRC 278
            V+   K+ +C
Sbjct: 177 EVHCDPKRVKC 187


>SB_58445| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 116

 Score = 28.7 bits (61), Expect = 5.7
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = -1

Query: 492 LLLI*SILKQSFVSKRFLPCMA--KYGWQQICLNFSISHNTCCICCN 358
           L+L+ + L   FVS RFLP  A     +++  +N    +N C   CN
Sbjct: 5   LILVLACLLTVFVSGRFLPQAAFDNTAYEECMMNCETEYNNCFSNCN 51


>SB_32630| Best HMM Match : 7tm_1 (HMM E-Value=4.1e-25)
          Length = 474

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 13/54 (24%), Positives = 24/54 (44%)
 Frame = -2

Query: 773 HYNVFPPIKFNPTPPHLIESSKIRC*VSAALLNVVSAKILSSTFNWPVYINVAM 612
           +Y +F  + FNP P         R  V+  +  ++   I+S   +W  Y  V++
Sbjct: 193 YYKIFRFLCFNPVPTAFASIRNNRRRVNVRITRMIMVSIISFVISWSPYCVVSV 246


>SB_6207| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 365

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 11/21 (52%), Positives = 12/21 (57%)
 Frame = +2

Query: 653 TGFWPRRHSIMLPILNIEFCC 715
           TGFW +R    LP LN  F C
Sbjct: 49  TGFWDKRQKGELPALNFAFHC 69


>SB_43634| Best HMM Match : Sushi (HMM E-Value=1.2e-16)
          Length = 986

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +3

Query: 402 GKSAATRIWPCTVEIFW--KQTTVLKWII*AASANECSFSRR 521
           G  AA+ +WP  + IFW  K+  V  W    +  +  SFSRR
Sbjct: 480 GNKAASGVWPWQIGIFWDSKRGFVAAWDR-PSEKHRPSFSRR 520


>SB_10205| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 985

 Score = 27.9 bits (59), Expect = 9.9
 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = +3

Query: 159  IKSIIKKIVLKRDKSEISFNIPKH--TVEYVHVNLMKKKKRCTI 284
            I  I +  +  R K      +P H  TV++VH  +   +K+CT+
Sbjct: 895  IAQIKRYAIDDRQKGRTKHTVPHHVLTVDHVHFMIADAEKKCTV 938


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,385,184
Number of Sequences: 59808
Number of extensions: 492521
Number of successful extensions: 1415
Number of sequences better than 10.0: 27
Number of HSP's better than 10.0 without gapping: 1243
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1412
length of database: 16,821,457
effective HSP length: 81
effective length of database: 11,977,009
effective search space used: 2167838629
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -