SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120016.Seq
         (678 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0)                       81   6e-16
SB_57814| Best HMM Match : RVT_thumb (HMM E-Value=5.6)                 78   8e-15
SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.)              78   8e-15
SB_52192| Best HMM Match : Fibrinogen_C (HMM E-Value=0.077)            78   8e-15
SB_42569| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 78   8e-15
SB_40877| Best HMM Match : RVT_1 (HMM E-Value=2.9e-28)                 78   8e-15
SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35)                    78   8e-15
SB_7050| Best HMM Match : RVT_thumb (HMM E-Value=5.6)                  78   8e-15
SB_3512| Best HMM Match : rve (HMM E-Value=4.7e-35)                    78   8e-15
SB_1340| Best HMM Match : rve (HMM E-Value=3.1e-14)                    78   8e-15
SB_697| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                   78   8e-15
SB_59245| Best HMM Match : SspH (HMM E-Value=5.7)                      78   8e-15
SB_54590| Best HMM Match : rve (HMM E-Value=4.8e-35)                   78   8e-15
SB_53290| Best HMM Match : RVT_1 (HMM E-Value=3.8e-31)                 78   8e-15
SB_45153| Best HMM Match : rve (HMM E-Value=0)                         78   8e-15
SB_39667| Best HMM Match : rve (HMM E-Value=9e-32)                     78   8e-15
SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.)              78   8e-15
SB_27987| Best HMM Match : RVT_1 (HMM E-Value=4.8e-32)                 78   8e-15
SB_14088| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 78   8e-15
SB_12609| Best HMM Match : rve (HMM E-Value=4.8e-35)                   78   8e-15
SB_12601| Best HMM Match : rve (HMM E-Value=5e-29)                     78   8e-15
SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35)                    78   8e-15
SB_4461| Best HMM Match : No HMM Matches (HMM E-Value=.)               78   8e-15
SB_3870| Best HMM Match : No HMM Matches (HMM E-Value=.)               78   8e-15
SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35)                   77   1e-14
SB_13231| Best HMM Match : DNA_pol_viral_C (HMM E-Value=2.1)           77   1e-14
SB_55673| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 77   1e-14
SB_154| Best HMM Match : RVT_1 (HMM E-Value=0.00044)                   77   2e-14
SB_23220| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 76   2e-14
SB_24490| Best HMM Match : RVT_1 (HMM E-Value=1e-32)                   75   5e-14
SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32)                   75   5e-14
SB_34095| Best HMM Match : No HMM Matches (HMM E-Value=.)              75   7e-14
SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39)                 74   1e-13
SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.)              74   1e-13
SB_8612| Best HMM Match : RVT_1 (HMM E-Value=2.1e-32)                  74   1e-13
SB_27499| Best HMM Match : RVT_1 (HMM E-Value=9.2e-39)                 74   1e-13
SB_2074| Best HMM Match : No HMM Matches (HMM E-Value=.)               74   1e-13
SB_51142| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)                 73   2e-13
SB_46896| Best HMM Match : PIG-L (HMM E-Value=1.5)                     73   2e-13
SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38)                 73   2e-13
SB_27768| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)                 73   2e-13
SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38)                 73   2e-13
SB_21103| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38)                 73   2e-13
SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   2e-13
SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19)                  73   2e-13
SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0)                       73   2e-13
SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37)                 73   2e-13
SB_44757| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   2e-13
SB_38698| Best HMM Match : MiaE (HMM E-Value=5.8)                      73   2e-13
SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)                 73   2e-13
SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   2e-13
SB_44297| Best HMM Match : RVT_1 (HMM E-Value=0)                       73   2e-13
SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0)                       73   2e-13
SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0)                       73   2e-13
SB_1761| Best HMM Match : ERF (HMM E-Value=6.8)                        73   2e-13
SB_42440| Best HMM Match : RnaseH (HMM E-Value=0.9)                    73   2e-13
SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   2e-13
SB_3438| Best HMM Match : RVT_1 (HMM E-Value=1.3e-30)                  73   2e-13
SB_53979| Best HMM Match : TetR_C (HMM E-Value=5.3)                    72   4e-13
SB_37892| Best HMM Match : rve (HMM E-Value=2.1e-16)                   72   4e-13
SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.)              72   4e-13
SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38)                 72   4e-13
SB_29623| Best HMM Match : GM_CSF (HMM E-Value=5)                      72   4e-13
SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17)                 72   4e-13
SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38)                 72   4e-13
SB_9562| Best HMM Match : TetR_C (HMM E-Value=4)                       72   4e-13
SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0)                       72   5e-13
SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18)                 72   5e-13
SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19)                 72   5e-13
SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.)              72   5e-13
SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015)                72   5e-13
SB_27075| Best HMM Match : rve (HMM E-Value=1.5e-16)                   72   5e-13
SB_51200| Best HMM Match : No HMM Matches (HMM E-Value=.)              71   1e-12
SB_2895| Best HMM Match : RnaseH (HMM E-Value=3.1)                     71   1e-12
SB_47235| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17)                 71   1e-12
SB_42289| Best HMM Match : RVT_1 (HMM E-Value=5.2e-17)                 71   1e-12
SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22)                   71   1e-12
SB_27043| Best HMM Match : No HMM Matches (HMM E-Value=.)              71   1e-12
SB_25628| Best HMM Match : RVT_1 (HMM E-Value=0.17)                    71   1e-12
SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.)              71   1e-12
SB_13654| Best HMM Match : No HMM Matches (HMM E-Value=.)              71   1e-12
SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17)                 70   2e-12
SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051)                70   2e-12
SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14)          70   2e-12
SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22)                   70   2e-12
SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17)                  69   3e-12
SB_3041| Best HMM Match : No HMM Matches (HMM E-Value=.)               69   3e-12
SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   3e-12
SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   3e-12
SB_46544| Best HMM Match : DUF1539 (HMM E-Value=6.2)                   69   3e-12
SB_37340| Best HMM Match : DUF1539 (HMM E-Value=8.4)                   69   3e-12
SB_33095| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   3e-12
SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.)              69   3e-12
SB_58536| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   8e-12
SB_58015| Best HMM Match : rve (HMM E-Value=0.00087)                   68   8e-12
SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.)              68   8e-12
SB_53144| Best HMM Match : RVT_thumb (HMM E-Value=0.14)                67   1e-11
SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30)                 67   1e-11
SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16)                   67   1e-11
SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34)                    67   1e-11
SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21)                   67   1e-11
SB_47242| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 67   1e-11
SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.)              67   1e-11
SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21)                   67   1e-11
SB_28476| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19)                 67   1e-11
SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 67   1e-11
SB_20593| Best HMM Match : RnaseH (HMM E-Value=1.9)                    67   1e-11
SB_50912| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 67   1e-11
SB_22228| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 67   1e-11
SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35)               67   1e-11
SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.)              66   2e-11
SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.)               66   2e-11
SB_8440| Best HMM Match : RVT_1 (HMM E-Value=4.3e-18)                  66   2e-11
SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.)               66   2e-11
SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   4e-11
SB_19382| Best HMM Match : rve (HMM E-Value=8.4e-26)                   65   4e-11
SB_1416| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37)                  65   4e-11
SB_51031| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37)                 65   4e-11
SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_50857| Best HMM Match : RVT_1 (HMM E-Value=9.8e-33)                 65   6e-11
SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37)                   65   6e-11
SB_29850| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_22266| Best HMM Match : Dimerisation (HMM E-Value=4.3)              65   6e-11
SB_49941| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_49147| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)                 65   6e-11
SB_31504| Best HMM Match : No HMM Matches (HMM E-Value=.)              65   6e-11
SB_28292| Best HMM Match : RVT_1 (HMM E-Value=2.3e-38)                 65   6e-11
SB_19411| Best HMM Match : RVT_1 (HMM E-Value=1.1e-32)                 65   6e-11
SB_1797| Best HMM Match : rve (HMM E-Value=8.5e-35)                    65   6e-11
SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35)                   64   8e-11
SB_16279| Best HMM Match : DNA_pol_viral_C (HMM E-Value=3.6)           64   8e-11
SB_19544| Best HMM Match : Ribosomal_S18 (HMM E-Value=4.9)             64   8e-11
SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18)                 64   8e-11
SB_6987| Best HMM Match : RVT_1 (HMM E-Value=2.2e-21)                  64   8e-11
SB_36806| Best HMM Match : RVT_1 (HMM E-Value=3.1e-35)                 64   1e-10
SB_15863| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   2e-10
SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)                 63   2e-10
SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   2e-10
SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066)                  63   2e-10
SB_20138| Best HMM Match : No HMM Matches (HMM E-Value=.)              63   2e-10
SB_38788| Best HMM Match : rve (HMM E-Value=4e-06)                     62   3e-10
SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36)                   62   3e-10
SB_31834| Best HMM Match : RVT_1 (HMM E-Value=0.019)                   62   3e-10
SB_28907| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   3e-10
SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   3e-10
SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.)              62   3e-10
SB_5085| Best HMM Match : Op_neuropeptide (HMM E-Value=1.6)            62   3e-10
SB_56354| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)                 62   3e-10
SB_4743| Best HMM Match : No HMM Matches (HMM E-Value=.)               62   3e-10
SB_35198| Best HMM Match : rve (HMM E-Value=8.1e-20)                   62   4e-10
SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0)                 62   4e-10
SB_284| Best HMM Match : rve (HMM E-Value=0.001)                       62   4e-10
SB_28182| Best HMM Match : RnaseH (HMM E-Value=1.8)                    62   4e-10
SB_13297| Best HMM Match : RnaseH (HMM E-Value=0.37)                   62   5e-10
SB_12220| Best HMM Match : RVT_1 (HMM E-Value=7.3e-19)                 62   5e-10
SB_39048| Best HMM Match : RVT_1 (HMM E-Value=1.9e-23)                 61   7e-10
SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)                 61   7e-10
SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30)                 61   9e-10
SB_16776| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   9e-10
SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011)                 61   9e-10
SB_51280| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_15534| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   1e-09
SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)                 60   2e-09
SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_28930| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30)                    60   2e-09
SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4)                60   2e-09
SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8)                 60   2e-09
SB_3147| Best HMM Match : No HMM Matches (HMM E-Value=.)               60   2e-09
SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_1422| Best HMM Match : Synaphin (HMM E-Value=7.3)                   60   2e-09
SB_52461| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_52459| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27)                 60   2e-09
SB_14926| Best HMM Match : No HMM Matches (HMM E-Value=.)              60   2e-09
SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019)                 59   3e-09
SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41)              59   3e-09
SB_17119| Best HMM Match : No HMM Matches (HMM E-Value=.)              59   4e-09
SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31)                   58   5e-09
SB_47002| Best HMM Match : RVT_1 (HMM E-Value=1.5e-16)                 58   5e-09
SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   5e-09
SB_47933| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   5e-09
SB_42293| Best HMM Match : RVT_1 (HMM E-Value=0.0012)                  58   5e-09
SB_21496| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   5e-09
SB_56338| Best HMM Match : DUF970 (HMM E-Value=1.9)                    58   7e-09
SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   7e-09
SB_33701| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   7e-09
SB_28310| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   7e-09
SB_21429| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   7e-09
SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   7e-09
SB_7810| Best HMM Match : RVT_1 (HMM E-Value=2.8026e-45)               58   7e-09
SB_3054| Best HMM Match : RVT_1 (HMM E-Value=1.6e-09)                  58   9e-09
SB_21960| Best HMM Match : rve (HMM E-Value=4e-23)                     58   9e-09
SB_24668| Best HMM Match : RVT_1 (HMM E-Value=0.4)                     57   1e-08
SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.)              57   1e-08
SB_18532| Best HMM Match : SspH (HMM E-Value=5.7)                      57   1e-08
SB_14434| Best HMM Match : RVT_1 (HMM E-Value=8e-34)                   57   1e-08
SB_17781| Best HMM Match : RVT_1 (HMM E-Value=1.3e-24)                 57   1e-08
SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.)               57   1e-08
SB_51136| Best HMM Match : Lac_bphage_repr (HMM E-Value=2.1)           56   2e-08
SB_39090| Best HMM Match : zf-piccolo (HMM E-Value=0.81)               56   2e-08
SB_13555| Best HMM Match : B5 (HMM E-Value=1.4)                        56   2e-08
SB_5144| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   2e-08
SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.)                56   2e-08
SB_57833| Best HMM Match : RnaseH (HMM E-Value=0.18)                   56   2e-08
SB_19811| Best HMM Match : RVT_1 (HMM E-Value=3.5e-32)                 56   3e-08
SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_4361| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_4267| Best HMM Match : No HMM Matches (HMM E-Value=.)               56   3e-08
SB_39524| Best HMM Match : rve (HMM E-Value=9.1e-17)                   56   3e-08
SB_7045| Best HMM Match : rve (HMM E-Value=3.8e-22)                    56   3e-08
SB_28190| Best HMM Match : RVT_thumb (HMM E-Value=6.2)                 55   5e-08
SB_24170| Best HMM Match : rve (HMM E-Value=0.61)                      55   5e-08
SB_56337| Best HMM Match : RVT_1 (HMM E-Value=1.7e-23)                 55   5e-08
SB_19469| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00048)       55   5e-08
SB_6210| Best HMM Match : No HMM Matches (HMM E-Value=.)               55   5e-08
SB_12920| Best HMM Match : zf-CCHC (HMM E-Value=6.2e-05)               55   6e-08
SB_45442| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   8e-08
SB_58082| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_17842| Best HMM Match : RVT_1 (HMM E-Value=2.2e-29)                 54   1e-07
SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)               54   1e-07
SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_39948| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_31972| Best HMM Match : RVT_1 (HMM E-Value=2.4e-14)                 54   1e-07
SB_21980| Best HMM Match : RVT_1 (HMM E-Value=1.5e-35)                 54   1e-07
SB_17670| Best HMM Match : RVT_1 (HMM E-Value=6.1e-25)                 54   1e-07
SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.)              54   1e-07
SB_27419| Best HMM Match : RVT_1 (HMM E-Value=0.00022)                 54   1e-07
SB_18645| Best HMM Match : RVT_1 (HMM E-Value=0.0003)                  54   1e-07
SB_8133| Best HMM Match : RVT_1 (HMM E-Value=1.7e-34)                  54   1e-07
SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.)              53   2e-07
SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10)                 53   2e-07
SB_26400| Best HMM Match : RVT_1 (HMM E-Value=1.1e-30)                 53   2e-07
SB_52711| Best HMM Match : rve (HMM E-Value=8.3e-05)                   52   3e-07
SB_52661| Best HMM Match : RVT_thumb (HMM E-Value=3)                   52   3e-07
SB_51002| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   3e-07
SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32)           52   3e-07
SB_29817| Best HMM Match : Keratin_B2 (HMM E-Value=6.3)                52   3e-07
SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12)                    52   3e-07
SB_4914| Best HMM Match : RVT_1 (HMM E-Value=2.5e-16)                  52   3e-07
SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)                 52   4e-07
SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13)                   52   4e-07
SB_4272| Best HMM Match : RVT_1 (HMM E-Value=2e-28)                    52   4e-07
SB_45121| Best HMM Match : rve (HMM E-Value=3.8e-09)                   52   4e-07
SB_19376| Best HMM Match : RVT_1 (HMM E-Value=6.7e-16)                 52   4e-07
SB_50156| Best HMM Match : RVT_1 (HMM E-Value=7.2e-37)                 52   6e-07
SB_48993| Best HMM Match : No HMM Matches (HMM E-Value=.)              52   6e-07
SB_17210| Best HMM Match : Op_neuropeptide (HMM E-Value=2.7)           52   6e-07
SB_15135| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)                 52   6e-07
SB_9368| Best HMM Match : No HMM Matches (HMM E-Value=.)               52   6e-07
SB_44255| Best HMM Match : RVT_1 (HMM E-Value=7.6e-29)                 52   6e-07
SB_18117| Best HMM Match : rve (HMM E-Value=1.7e-29)                   52   6e-07
SB_55980| Best HMM Match : rve (HMM E-Value=3.8e-23)                   51   7e-07
SB_51517| Best HMM Match : RVT_1 (HMM E-Value=0.0053)                  50   1e-06
SB_27585| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   1e-06
SB_18177| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   1e-06
SB_14634| Best HMM Match : ATP-synt_E (HMM E-Value=2.6)                50   1e-06
SB_39051| Best HMM Match : Gal_Lectin (HMM E-Value=2.5e-21)            50   2e-06
SB_54652| Best HMM Match : Retrotrans_gag (HMM E-Value=0.52)           50   2e-06
SB_24148| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_9047| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)                  50   2e-06
SB_56818| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)                 50   2e-06
SB_54094| Best HMM Match : RnaseH (HMM E-Value=0.022)                  50   2e-06
SB_53641| Best HMM Match : rve (HMM E-Value=7.9e-14)                   50   2e-06
SB_33232| Best HMM Match : RnaseH (HMM E-Value=0.56)                   50   2e-06
SB_27280| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_19010| Best HMM Match : Dimerisation (HMM E-Value=9.8)              50   2e-06
SB_18792| Best HMM Match : No HMM Matches (HMM E-Value=.)              50   2e-06
SB_17076| Best HMM Match : RVT_thumb (HMM E-Value=3.9)                 50   2e-06
SB_14213| Best HMM Match : RVT_1 (HMM E-Value=1.4e-24)                 50   2e-06
SB_9289| Best HMM Match : EGF_2 (HMM E-Value=6.1)                      50   2e-06
SB_6769| Best HMM Match : rve (HMM E-Value=3.5e-19)                    50   2e-06
SB_1718| Best HMM Match : I-set (HMM E-Value=3.8e-07)                  50   2e-06
SB_54911| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)                 50   2e-06
SB_44436| Best HMM Match : RnaseH (HMM E-Value=0.0048)                 50   2e-06
SB_44138| Best HMM Match : RVT_1 (HMM E-Value=3.2e-26)                 50   2e-06
SB_16804| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)                 50   2e-06
SB_11912| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)                 50   2e-06
SB_4782| Best HMM Match : No HMM Matches (HMM E-Value=.)               50   2e-06
SB_2280| Best HMM Match : RVT_1 (HMM E-Value=1.4e-25)                  50   2e-06
SB_1625| Best HMM Match : No HMM Matches (HMM E-Value=.)               50   2e-06
SB_51570| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_31354| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_27892| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17)                   49   3e-06
SB_20221| Best HMM Match : RVT_1 (HMM E-Value=0.00045)                 49   3e-06
SB_16415| Best HMM Match : RVT_1 (HMM E-Value=0.00052)                 49   3e-06
SB_15656| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_12337| Best HMM Match : RVT_1 (HMM E-Value=0.00049)                 49   3e-06
SB_9404| Best HMM Match : RVT_1 (HMM E-Value=0.00051)                  49   3e-06
SB_9072| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18)                  49   3e-06
SB_58621| Best HMM Match : RVT_1 (HMM E-Value=1.5e-25)                 49   3e-06
SB_36000| Best HMM Match : DUF1379 (HMM E-Value=4.8)                   49   3e-06
SB_23879| Best HMM Match : rve (HMM E-Value=2.2e-17)                   49   3e-06
SB_23778| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_23421| Best HMM Match : rve (HMM E-Value=1.8e-18)                   49   3e-06
SB_21695| Best HMM Match : RVT_1 (HMM E-Value=0.00068)                 49   3e-06
SB_12900| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   3e-06
SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07)                 49   4e-06
SB_54562| Best HMM Match : RVT_1 (HMM E-Value=1.4e-06)                 49   4e-06
SB_52359| Best HMM Match : FCD (HMM E-Value=7.8)                       49   4e-06
SB_49727| Best HMM Match : RVT_1 (HMM E-Value=4.5e-07)                 49   4e-06
SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_36517| Best HMM Match : RVT_1 (HMM E-Value=1.4e-06)                 49   4e-06
SB_22667| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07)                 49   4e-06
SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11)                   49   4e-06
SB_4623| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07)                  49   4e-06
SB_1237| Best HMM Match : rve (HMM E-Value=0.00029)                    49   4e-06
SB_57312| Best HMM Match : RVT_1 (HMM E-Value=0.0069)                  49   4e-06
SB_35469| Best HMM Match : No HMM Matches (HMM E-Value=.)              49   4e-06
SB_34709| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07)                 49   4e-06
SB_34271| Best HMM Match : RVT_1 (HMM E-Value=3.4e-07)                 49   4e-06
SB_24375| Best HMM Match : rve (HMM E-Value=7.2e-15)                   49   4e-06
SB_4973| Best HMM Match : RVT_1 (HMM E-Value=8.6e-11)                  49   4e-06
SB_709| Best HMM Match : RVT_1 (HMM E-Value=0.0021)                    49   4e-06
SB_56113| Best HMM Match : zf-CCHC (HMM E-Value=0.0026)                48   5e-06
SB_20587| Best HMM Match : rve (HMM E-Value=7.2e-15)                   48   5e-06
SB_21706| Best HMM Match : RVT_1 (HMM E-Value=6.6e-19)                 48   5e-06
SB_10363| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   5e-06
SB_55052| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   7e-06
SB_31380| Best HMM Match : zf-CCHC (HMM E-Value=4.6e-05)               48   7e-06
SB_36929| Best HMM Match : rve (HMM E-Value=1.2e-16)                   48   7e-06
SB_31154| Best HMM Match : rve (HMM E-Value=2.5e-12)                   48   7e-06
SB_10506| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9)             48   7e-06
SB_7613| Best HMM Match : DNA_pol3_beta (HMM E-Value=4.9)              48   7e-06
SB_55168| Best HMM Match : rve (HMM E-Value=2.2e-17)                   48   9e-06
SB_53754| Best HMM Match : M-factor (HMM E-Value=5.8)                  48   9e-06
SB_23305| Best HMM Match : RVT_1 (HMM E-Value=0.0013)                  48   9e-06
SB_17130| Best HMM Match : RVT_1 (HMM E-Value=0.0013)                  48   9e-06
SB_11383| Best HMM Match : rve (HMM E-Value=2.3e-18)                   48   9e-06
SB_7968| Best HMM Match : RVT_1 (HMM E-Value=0.25)                     48   9e-06
SB_53393| Best HMM Match : RVT_1 (HMM E-Value=5.8e-30)                 47   1e-05
SB_55708| Best HMM Match : UPF0103 (HMM E-Value=0.87)                  47   1e-05
SB_53100| Best HMM Match : HMD (HMM E-Value=2.8)                       47   1e-05
SB_45708| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   1e-05
SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   1e-05
SB_18831| Best HMM Match : RVT_1 (HMM E-Value=0.0066)                  46   2e-05
SB_13455| Best HMM Match : No HMM Matches (HMM E-Value=.)              46   2e-05
SB_48889| Best HMM Match : DUF234 (HMM E-Value=2)                      46   3e-05
SB_48817| Best HMM Match : DUF1154 (HMM E-Value=6.3)                   46   3e-05
SB_2104| Best HMM Match : No HMM Matches (HMM E-Value=.)               46   3e-05
SB_27036| Best HMM Match : RVT_1 (HMM E-Value=0.00041)                 46   3e-05
SB_13803| Best HMM Match : rve (HMM E-Value=8.6e-14)                   46   4e-05
SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.)               46   4e-05
SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36)                 46   4e-05
SB_2438| Best HMM Match : No HMM Matches (HMM E-Value=.)               45   5e-05
SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07)                 45   5e-05
SB_47407| Best HMM Match : RnaseH (HMM E-Value=5.9)                    45   7e-05
SB_44967| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_37239| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19)                 45   7e-05
SB_15390| Best HMM Match : rve (HMM E-Value=5.2e-36)                   45   7e-05
SB_50618| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00017)         45   7e-05
SB_18945| Best HMM Match : No HMM Matches (HMM E-Value=.)              45   7e-05
SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05)               44   9e-05
SB_15292| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   9e-05
SB_25027| Best HMM Match : EGF_2 (HMM E-Value=5.8)                     44   9e-05
SB_48015| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_27367| Best HMM Match : rve (HMM E-Value=9.5e-17)                   44   1e-04
SB_22668| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   1e-04
SB_17286| Best HMM Match : RVT_1 (HMM E-Value=1.5e-05)                 44   1e-04
SB_10216| Best HMM Match : RVT_1 (HMM E-Value=0.00039)                 44   1e-04
SB_42812| Best HMM Match : RVT_1 (HMM E-Value=8.4e-19)                 44   1e-04
SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11)                 44   1e-04
SB_59677| Best HMM Match : RVT_1 (HMM E-Value=2.1e-28)                 44   2e-04
SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_49821| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_41743| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_31801| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_21567| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18)                 44   2e-04
SB_18229| Best HMM Match : RVT_1 (HMM E-Value=0.82)                    44   2e-04
SB_58058| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_48661| Best HMM Match : rve (HMM E-Value=5.7e-17)                   44   2e-04
SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.)              44   2e-04
SB_34394| Best HMM Match : RVT_1 (HMM E-Value=8.7e-08)                 44   2e-04
SB_57121| Best HMM Match : FCD (HMM E-Value=9.4)                       43   2e-04
SB_17257| Best HMM Match : rve (HMM E-Value=8.3e-08)                   43   2e-04
SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   2e-04
SB_59142| Best HMM Match : RVT_1 (HMM E-Value=2.5e-09)                 43   3e-04
SB_53136| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)                 43   3e-04
SB_51755| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_34627| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_26304| Best HMM Match : RVT_1 (HMM E-Value=2.3e-27)                 43   3e-04
SB_26129| Best HMM Match : RVT_1 (HMM E-Value=1.2e-27)                 43   3e-04
SB_25074| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_15856| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27)                 43   3e-04
SB_6874| Best HMM Match : RnaseH (HMM E-Value=1.6)                     43   3e-04
SB_3691| Best HMM Match : DUF1520 (HMM E-Value=5.7)                    43   3e-04
SB_51857| Best HMM Match : zf-CCHC (HMM E-Value=0.0048)                43   3e-04
SB_49099| Best HMM Match : rve (HMM E-Value=2e-08)                     43   3e-04
SB_37459| Best HMM Match : DUF1520 (HMM E-Value=5.7)                   43   3e-04
SB_31097| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_28694| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)                 43   3e-04
SB_28242| Best HMM Match : RVT_1 (HMM E-Value=2.2e-27)                 43   3e-04
SB_25606| Best HMM Match : RnaseH (HMM E-Value=1.6)                    43   3e-04
SB_24991| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_22848| Best HMM Match : RVT_1 (HMM E-Value=5.1e-15)                 43   3e-04
SB_22028| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21)                 43   3e-04
SB_14854| Best HMM Match : No HMM Matches (HMM E-Value=.)              43   3e-04
SB_7494| Best HMM Match : RVT_1 (HMM E-Value=4.6e-28)                  43   3e-04
SB_3197| Best HMM Match : No HMM Matches (HMM E-Value=.)               43   3e-04
SB_56918| Best HMM Match : zf-CCHC (HMM E-Value=7.4e-07)               42   3e-04
SB_56534| Best HMM Match : RVT_1 (HMM E-Value=5.5e-28)                 42   3e-04
SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24)                   42   3e-04
SB_49535| Best HMM Match : RVT_1 (HMM E-Value=5.1e-32)                 42   3e-04
SB_49131| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21)                 42   3e-04
SB_35539| Best HMM Match : RVT_1 (HMM E-Value=1.7e-07)                 42   3e-04
SB_26992| Best HMM Match : rve (HMM E-Value=6.3e-36)                   42   3e-04
SB_25586| Best HMM Match : RVT_1 (HMM E-Value=2.3e-18)                 42   3e-04
SB_22623| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21)                 42   3e-04
SB_11464| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21)                 42   3e-04
SB_5734| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21)                  42   3e-04
SB_2480| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   3e-04
SB_56418| Best HMM Match : Peptidase_A17 (HMM E-Value=1.3e-35)         42   3e-04
SB_52157| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_45792| Best HMM Match : RVT_1 (HMM E-Value=3.5e-26)                 42   3e-04
SB_45032| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21)                 42   3e-04
SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36)                   42   3e-04
SB_35114| Best HMM Match : RVT_1 (HMM E-Value=2.2e-11)                 42   3e-04
SB_30012| Best HMM Match : Retrotrans_gag (HMM E-Value=1.1)            42   3e-04
SB_29927| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_27411| Best HMM Match : RVT_1 (HMM E-Value=0.002)                   42   3e-04
SB_17947| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_15684| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   3e-04
SB_15492| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21)                 42   3e-04
SB_15089| Best HMM Match : RVT_1 (HMM E-Value=6.6e-21)                 42   3e-04
SB_9739| Best HMM Match : No HMM Matches (HMM E-Value=.)               42   3e-04
SB_9297| Best HMM Match : RVT_1 (HMM E-Value=7e-21)                    42   3e-04
SB_5024| Best HMM Match : rve (HMM E-Value=6.3e-36)                    42   3e-04
SB_24| Best HMM Match : No HMM Matches (HMM E-Value=.)                 42   3e-04
SB_39683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021)               42   5e-04
SB_58972| Best HMM Match : RVT_1 (HMM E-Value=0.013)                   42   5e-04
SB_55857| Best HMM Match : STN (HMM E-Value=6)                         42   5e-04
SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18)                   42   5e-04
SB_53950| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_52907| Best HMM Match : RVT_1 (HMM E-Value=2.4e-17)                 42   6e-04
SB_56471| Best HMM Match : RVT_1 (HMM E-Value=0.00041)                 42   6e-04
SB_31861| Best HMM Match : rve (HMM E-Value=3.6e-07)                   42   6e-04
SB_25898| Best HMM Match : rve (HMM E-Value=1)                         42   6e-04
SB_9257| Best HMM Match : RVT_1 (HMM E-Value=9.1e-32)                  42   6e-04
SB_57871| Best HMM Match : RVT_1 (HMM E-Value=0.0029)                  41   8e-04
SB_42224| Best HMM Match : rve (HMM E-Value=8.6e-14)                   41   8e-04
SB_35577| Best HMM Match : RVP (HMM E-Value=3e-05)                     41   8e-04
SB_30405| Best HMM Match : rve (HMM E-Value=5.1e-07)                   41   8e-04
SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08)                 41   8e-04
SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08)                 41   8e-04
SB_15324| Best HMM Match : RVP (HMM E-Value=8.1e-05)                   41   8e-04
SB_10983| Best HMM Match : RVP (HMM E-Value=3.8e-05)                   41   8e-04
SB_3336| Best HMM Match : Antimicrobial_9 (HMM E-Value=2.2)            41   8e-04
SB_46264| Best HMM Match : rve (HMM E-Value=1.9e-16)                   41   0.001
SB_41330| Best HMM Match : Destabilase (HMM E-Value=5)                 41   0.001
SB_16736| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17)                 41   0.001
SB_9645| Best HMM Match : DUF101 (HMM E-Value=4.3)                     41   0.001
SB_52945| Best HMM Match : RVT_1 (HMM E-Value=7.2e-19)                 41   0.001
SB_57835| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.001
SB_40600| Best HMM Match : DUF667 (HMM E-Value=0.35)                   40   0.001
SB_8223| Best HMM Match : RVT_1 (HMM E-Value=4e-27)                    40   0.001
SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_43121| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 40   0.002
SB_42447| Best HMM Match : RVT_1 (HMM E-Value=1.5e-32)                 40   0.002
SB_33029| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     40   0.002
SB_24657| Best HMM Match : RVP (HMM E-Value=0.02)                      40   0.002
SB_23785| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_411| Best HMM Match : RVT_1 (HMM E-Value=2.5e-29)                   40   0.002
SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_53217| Best HMM Match : RVT_1 (HMM E-Value=3.1e-13)                 40   0.002
SB_45140| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 40   0.002
SB_43351| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_39931| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 40   0.002
SB_29480| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 40   0.002
SB_28069| Best HMM Match : RVT_1 (HMM E-Value=1.8e-28)                 40   0.002
SB_22521| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)                 40   0.002
SB_16795| Best HMM Match : No HMM Matches (HMM E-Value=.)              40   0.002
SB_8944| Best HMM Match : RVT_1 (HMM E-Value=1.3e-05)                  40   0.002
SB_993| Best HMM Match : rve (HMM E-Value=2.7e-33)                     40   0.002
SB_54204| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.003
SB_52035| Best HMM Match : RVT_1 (HMM E-Value=0.067)                   39   0.003
SB_51205| Best HMM Match : RVT_1 (HMM E-Value=1.7e-21)                 39   0.003
SB_10776| Best HMM Match : RVT_1 (HMM E-Value=2e-27)                   39   0.003
SB_56215| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_54943| Best HMM Match : RWD (HMM E-Value=6.6)                       39   0.004
SB_37431| Best HMM Match : No HMM Matches (HMM E-Value=.)              39   0.004
SB_8975| Best HMM Match : No HMM Matches (HMM E-Value=.)               39   0.004
SB_53063| Best HMM Match : DUF359 (HMM E-Value=2.9)                    39   0.004
SB_5315| Best HMM Match : RVT_1 (HMM E-Value=2.6e-26)                  38   0.006
SB_3606| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.006
SB_58785| Best HMM Match : RnaseH (HMM E-Value=0.37)                   38   0.006
SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32)                 38   0.006
SB_34858| Best HMM Match : RVT_1 (HMM E-Value=2.9e-19)                 38   0.006
SB_30990| Best HMM Match : RhoGEF (HMM E-Value=2.1)                    38   0.006
SB_8019| Best HMM Match : No HMM Matches (HMM E-Value=.)               38   0.006
SB_5227| Best HMM Match : RnaseH (HMM E-Value=1.8)                     38   0.006
SB_2983| Best HMM Match : RnaseH (HMM E-Value=1.6)                     38   0.006
SB_1020| Best HMM Match : YebG (HMM E-Value=5.5)                       38   0.006
SB_8127| Best HMM Match : RVT_1 (HMM E-Value=0)                        38   0.007
SB_47769| Best HMM Match : zf-CCHC (HMM E-Value=0.00034)               38   0.010
SB_40863| Best HMM Match : RVT_1 (HMM E-Value=0.00014)                 38   0.010

>SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 2639

 Score = 81.4 bits (192), Expect = 6e-16
 Identities = 33/81 (40%), Positives = 55/81 (67%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            FQ + +  I +NP KC F   EV +LG+ +S  G +P   +I+A++++P P+ V+ +R F
Sbjct: 839  FQRLRNANIKLNPKKCTFAKSEVEYLGHIVSTAGIKPNPAKIKAVQEYPRPKNVRDVRSF 898

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +G+ NYYRRF+++ AK+  PL
Sbjct: 899  LGLANYYRRFVKDFAKIARPL 919



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 25/50 (50%), Positives = 29/50 (58%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           T+DL   Y QI VAPE   KTA IT  G YEFN + FGL  +   F R +
Sbjct: 753 TLDLRNGYWQIAVAPESREKTAFITHEGTYEFNVLPFGLVGSPSCFSRLM 802



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
            W+ + +  F+  K +L SA ++A+P  N    L+TDAS+  +G
Sbjct: 931  WSQDAQAAFDLLKRALVSAPILAYPDFNLTFQLYTDASAEGIG 973



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           C  Y+DDI+V+S    +H   L  +F+RL+
Sbjct: 814 CLVYLDDIIVFSTTFEEHLKDLEEVFQRLR 843


>SB_57814| Best HMM Match : RVT_thumb (HMM E-Value=5.6)
          Length = 223

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 86  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 145

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 146 LNYYACYIPNITTILSPLHQLLV 168



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +3

Query: 12  LVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           L +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 2   LSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 49



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 171 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 217


>SB_56941| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1034

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 86  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 145

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 146 LNYYACYIPNITTILSPLHQLLV 168



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 18/48 (37%), Positives = 29/48 (60%)
 Frame = +3

Query: 12  LVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           L +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 2   LSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 49



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 171 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 217


>SB_52192| Best HMM Match : Fibrinogen_C (HMM E-Value=0.077)
          Length = 723

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 39  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 98

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 99  LNYYACYIPNITTILSPLHQLLV 121



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 124 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 170


>SB_42569| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)
          Length = 342

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 169 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 228

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 229 LNYYACYIPNITTILSPLHQLLV 251



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 83  LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 132



 Score = 31.9 bits (69), Expect = 0.49
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 254 TPWNWSEAQEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 300


>SB_40877| Best HMM Match : RVT_1 (HMM E-Value=2.9e-28)
          Length = 734

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 616 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 675

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 676 LNYYACYIPNITTILSPLHQLLV 698



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 530 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 579


>SB_9298| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1514

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 486 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 545

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 546 LNYYACYIPNITTILSPLHQLLV 568



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 571 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 617



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
 Frame = +3

Query: 18  KAYQQI-PVAPEDICK-TAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           K+Y  +  +  ED  K T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 402 KSYADLCTLLDEDSRKYTPITTHKGLFEYNRLCYGIASAPGIFQRTME 449


>SB_7050| Best HMM Match : RVT_thumb (HMM E-Value=5.6)
          Length = 212

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 102 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 161

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 162 LNYYACYIPNITTILSPLHQLLV 184



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 16  LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 65


>SB_3512| Best HMM Match : rve (HMM E-Value=4.7e-35)
          Length = 1073

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 39  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 98

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 99  LNYYACYIPNITTILSPLHQLLV 121



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 124 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 170


>SB_1340| Best HMM Match : rve (HMM E-Value=3.1e-14)
          Length = 825

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 166 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 225

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 226 LNYYACYIPNITTILSPLHQLLV 248



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 251 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 297


>SB_697| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)
          Length = 603

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 503 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 562

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 563 LNYYACYIPNITTILSPLHQLLV 585



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 417 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 466


>SB_59245| Best HMM Match : SspH (HMM E-Value=5.7)
          Length = 275

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 102 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 161

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 162 LNYYACYIPNITTILSPLHQLLV 184



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 16  LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 65



 Score = 31.1 bits (67), Expect = 0.86
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 187 TPWNWSEAHEKYWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 233


>SB_54590| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1309

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 589 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 648

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 649 LNYYACYIPNITTILSPLHQLLV 671



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 503 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 552



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 674 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 720


>SB_53290| Best HMM Match : RVT_1 (HMM E-Value=3.8e-31)
          Length = 1090

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 620 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 679

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 680 LNYYACYIPNITTILSPLHQLLV 702



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N +  G+ +A   FQR ++
Sbjct: 534 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCCGIASAPGIFQRTME 583



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 705 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 751


>SB_45153| Best HMM Match : rve (HMM E-Value=0)
          Length = 2264

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 1528 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 1587

Query: 433  VNYYRRFLRNAAKLQAPLVNAIV 501
            +NYY  ++ N   + +PL   +V
Sbjct: 1588 LNYYACYIPNITTILSPLHQLLV 1610



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 31/83 (37%), Positives = 54/83 (65%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+  +GM
Sbjct: 543 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAXLGM 602

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 603 LNYYACYIPNITTILSPLHQLLV 625



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 457 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 506



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
            +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 1442 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 1491



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 628 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 674



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522  TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
            TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 1613 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLKRELTLACDASPYGLG 1659


>SB_39667| Best HMM Match : rve (HMM E-Value=9e-32)
          Length = 1845

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 546 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 605

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 606 LNYYACYIPNITTILSPLHQLLV 628



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 631 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 677


>SB_31650| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3212

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 620 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 679

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 680 LNYYACYIPNITTILSPLHQLLV 702



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 534 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 583



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 705 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 751


>SB_27987| Best HMM Match : RVT_1 (HMM E-Value=4.8e-32)
          Length = 779

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 620 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 679

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 680 LNYYACYIPNITTILSPLHQLLV 702



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 534 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 583



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 705 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 751


>SB_14088| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)
          Length = 621

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 448 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 507

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 508 LNYYACYIPNITTILSPLHQLLV 530



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 362 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 411



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 18/47 (38%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   EE +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 533 TPWNWSEAHEESWNQAKSTLHSSQLLVHYSWERELTLACDASPYGLG 579


>SB_12609| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 623

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 39  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 98

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 99  LNYYACYIPNITTILSPLHQLLV 121



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 124 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 170


>SB_12601| Best HMM Match : rve (HMM E-Value=5e-29)
          Length = 568

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 39  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 98

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 99  LNYYACYIPNITTILSPLHQLLV 121



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 124 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 170


>SB_9355| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1520

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 829  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 888

Query: 433  VNYYRRFLRNAAKLQAPLVNAIV 501
            +NYY  ++ N   + +PL   +V
Sbjct: 889  LNYYACYIPNITTILSPLHQLLV 911



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 743 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 792



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522  TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
            TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 914  TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 960


>SB_4461| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 747

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 618 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 677

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 678 LNYYACYIPNITTILSPLHQLLV 700



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 532 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 581



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 16/42 (38%), Positives = 22/42 (52%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDAS 647
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS
Sbjct: 703 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDAS 744


>SB_3870| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 859

 Score = 77.8 bits (183), Expect = 8e-15
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 686 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 745

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 746 LNYYACYIPNITTILSPLHQLLV 768



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 19/50 (38%), Positives = 30/50 (60%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N +  G+ +A   FQR ++
Sbjct: 600 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCCGIASAPGIFQRTME 649



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 771 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 817


>SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1671

 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 31/78 (39%), Positives = 53/78 (67%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 793  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 852

Query: 433  VNYYRRFLRNAAKLQAPL 486
            +NYY  ++ N   + +PL
Sbjct: 853  LNYYACYIPNITTILSPL 870



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 707 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 756


>SB_13231| Best HMM Match : DNA_pol_viral_C (HMM E-Value=2.1)
          Length = 390

 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 32/83 (38%), Positives = 54/83 (65%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 39  LDKAGVRLKRSKCIFQAPEVTYLGQRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 98

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 99  LNYYACYIPNITTVLSPLHQLLV 121



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 124 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 170


>SB_55673| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)
          Length = 249

 Score = 77.0 bits (181), Expect = 1e-14
 Identities = 31/78 (39%), Positives = 53/78 (67%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 169 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 228

Query: 433 VNYYRRFLRNAAKLQAPL 486
           +NYY  ++ N   + +PL
Sbjct: 229 LNYYACYIPNITTILSPL 246



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 83  LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 132


>SB_154| Best HMM Match : RVT_1 (HMM E-Value=0.00044)
          Length = 1170

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 33/85 (38%), Positives = 53/85 (62%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ + ++G+ I P+KC F   +V +LG+ +SADG     E+ +A+   P+P TV  LR F
Sbjct: 848  FRKLREHGLKIEPSKCQFFRGQVPYLGHIVSADGVATDPEKTKAVSALPVPSTVHDLRSF 907

Query: 424  IGMVNYYRRFLRNAAKLQAPLVNAI 498
            +G  +YYRRF+   A++  PL  A+
Sbjct: 908  LGFASYYRRFVPKFAQVAGPLHRAV 932



 Score = 35.5 bits (78), Expect = 0.040
 Identities = 16/46 (34%), Positives = 28/46 (60%)
 Frame = +3

Query: 528  ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            + WTPE +  F+  +  L++A ++A+P  N    + TDAS+  +GA
Sbjct: 950  VLWTPECQAAFDQLRTLLTTAPVLAYPDYNQPFIVETDASNEGLGA 995



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 12/39 (30%), Positives = 23/39 (58%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y+DDI+V++    +H   L  +F++L+    L I+ + C
Sbjct: 826 YLDDIIVFAESIDEHLRRLEVVFRKLR-EHGLKIEPSKC 863


>SB_23220| Best HMM Match : RVT_1 (HMM E-Value=3.8e-32)
          Length = 1597

 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 31/83 (37%), Positives = 54/83 (65%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 776  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGM 835

Query: 433  VNYYRRFLRNAAKLQAPLVNAIV 501
            +NYY  ++ N   + +P    +V
Sbjct: 836  LNYYACYIPNITTILSPFHQLLV 858



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 690 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 739


>SB_24490| Best HMM Match : RVT_1 (HMM E-Value=1e-32)
          Length = 792

 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 32/83 (38%), Positives = 54/83 (65%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  GI +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++   P  ++ L+ F+GM
Sbjct: 322 LDKAGIRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESQRPSNLKELQAFLGM 381

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 382 LNYYACYIPNITTILSPLHQLLV 404



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 236 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 285


>SB_20314| Best HMM Match : RVT_1 (HMM E-Value=1e-32)
          Length = 1556

 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 32/83 (38%), Positives = 54/83 (65%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            ++  GI +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++   P  ++ L+ F+GM
Sbjct: 865  LDKAGIRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESQRPSNLKELQAFLGM 924

Query: 433  VNYYRRFLRNAAKLQAPLVNAIV 501
            +NYY  ++ N   + +PL   +V
Sbjct: 925  LNYYACYIPNITTILSPLHQLLV 947



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 779 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 828


>SB_34095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 465

 Score = 74.5 bits (175), Expect = 7e-14
 Identities = 33/96 (34%), Positives = 54/96 (56%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  ++ +G+ + P KC F   EV +LG+ +S +      E+  A+++ P+P TV+ LR F
Sbjct: 53  FSKLKQHGLKVEPQKCKFFCSEVAYLGHVVSPESVSTDPEKTAAVRELPVPTTVRNLRSF 112

Query: 424 IGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRS 531
           +G  +YYRRF+   A++  PL   + A     S RS
Sbjct: 113 LGFASYYRRFVPKFAQIAGPLHQVVAAMGSGGSKRS 148


>SB_49539| Best HMM Match : RVT_1 (HMM E-Value=1.8e-39)
          Length = 1311

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 35/84 (41%), Positives = 51/84 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G +P  E+++A+ D P P  V  LR F+
Sbjct: 454 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVRPSPEKVRAVVDAPAPTNVTELRSFL 513

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 514 GMLQYYGKFLPNLSTLLHPLNNLL 537



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 370 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQFTID 419



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 544 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 588



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 423 KGIDGVVCYIDDILIAGRNDQEHKARLEAVLERLE 457


>SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1198

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 28/81 (34%), Positives = 54/81 (66%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ +    + +NPAKC F   ++ +LG+ I+ +G  P   +++A+ ++P P+ ++ LR F
Sbjct: 399 FERLRAANLKLNPAKCDFAKKKLQYLGHVITPEGISPSGSKVKAVSEYPPPRNLKELRCF 458

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +GM+N+YRRF+++ A +  PL
Sbjct: 459 LGMINFYRRFIKDFAAIARPL 479



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 17/43 (39%), Positives = 25/43 (58%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+PE  + F   KDSL SA ++  P  +    L TDAS++ +G
Sbjct: 491 WSPECNQAFQTLKDSLLSAPILVVPDFSKAFHLITDASATGIG 533



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 11/33 (33%), Positives = 21/33 (63%)
 Frame = +2

Query: 161 YDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           Y     Y+DD++++S+   +H  HL  +F+RL+
Sbjct: 371 YKCALIYIDDLIIFSKSEEEHLEHLAEIFERLR 403


>SB_8612| Best HMM Match : RVT_1 (HMM E-Value=2.1e-32)
          Length = 621

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 33/84 (39%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +1

Query: 253 IEDYGIVINPAKC-VFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIG 429
           ++  G+ +  +KC VF APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+G
Sbjct: 447 LDKAGVRLKRSKCIVFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLG 506

Query: 430 MVNYYRRFLRNAAKLQAPLVNAIV 501
           M+NYY  ++ N   + +PL   +V
Sbjct: 507 MLNYYACYIPNITTILSPLHQLLV 530



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 361 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 410



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 533 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 579


>SB_27499| Best HMM Match : RVT_1 (HMM E-Value=9.2e-39)
          Length = 872

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 267 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPNNVTELRSFL 326

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 327 GMLQYYGKFLPNLSTLLHPLNNLL 350



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 183 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 232



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 357 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 401



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +S D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 236 KSIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 270


>SB_2074| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1266

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 798  ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPNNVTELRSFL 857

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
            GM+ YY +FL N + L  PL N +
Sbjct: 858  GMLQYYGKFLPNLSTLLHPLNNLL 881



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 714 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 763



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531  TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 888  SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 932



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +S D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 767 KSIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 801


>SB_51142| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)
          Length = 370

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 153 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 212

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 213 GMLQYYGKFLPNLSTLLHPLNNLL 236



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 69  LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 118



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 243 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 287



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 122 KGIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 156


>SB_46896| Best HMM Match : PIG-L (HMM E-Value=1.5)
          Length = 312

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 34/78 (43%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +N  KC F  P V FLG+ I   G +P   + +A+K FP PQTV  L+RF+GM
Sbjct: 18  LQEAGVTLNE-KCEFSKPSVKFLGHIIDQSGVRPDPAKTEAIKSFPTPQTVNDLQRFMGM 76

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN   +FL + A L  PL
Sbjct: 77  VNQMGKFLPSLANLNEPL 94



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W    ++ F   K+ L+S+  +AH  PN    + +DAS+  +GA
Sbjct: 106 WGESQQQSFTRIKEELTSSRSLAHYDPNRPTIVSSDASNLGIGA 149


>SB_39101| Best HMM Match : RVT_1 (HMM E-Value=2.4e-38)
          Length = 856

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 699 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 758

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 759 GMLQYYGKFLPNLSTLLHPLNNLL 782



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 19/50 (38%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  +      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 615 LDLKHAYQQLPLGEKSKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 664



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 789 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 833



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 668 KGIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 702


>SB_27768| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)
          Length = 366

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 209 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 268

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 269 GMLQYYGKFLPNLSTLLHPLNNLL 292



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 125 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 174



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 299 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 343



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 178 KGIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 212


>SB_25140| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38)
          Length = 1425

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 1268 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 1327

Query: 427  GMVNYYRRFLRNAAKLQAPLVNAI 498
            GM+ YY +FL N + L  PL N +
Sbjct: 1328 GMLQYYGKFLPNLSTLLHPLNNLL 1351



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
            +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 1184 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 1233



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 30  SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 74



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531  TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 1358 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 1402



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 155  RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            +  D    Y+DDIL+  R+  +H A    + +RL+
Sbjct: 1237 KGIDGVVCYIDDILITGRNNQKHKARFEAVLERLE 1271


>SB_21103| Best HMM Match : RVT_1 (HMM E-Value=7.8e-38)
          Length = 366

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 209 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 268

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 269 GMLQYYGKFLPNLSTLLHPLNNLL 292



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 125 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 174



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 299 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 343



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 11/35 (31%), Positives = 19/35 (54%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A    + +RL+
Sbjct: 178 KGIDGVVCYIDDILITGRNNQKHKARFEAVLERLE 212


>SB_14676| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 905

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 30/76 (39%), Positives = 51/76 (67%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP+K      EV+++G+R+++ G QP  E+IQA+ D P P   +G++R IG VN
Sbjct: 553 EVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIQAIIDMPPPTDKEGVQRLIGTVN 612

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F++N A++Q P+
Sbjct: 613 YLDKFIQNKAEIQGPI 628


>SB_58000| Best HMM Match : MATH (HMM E-Value=1.1e-19)
          Length = 1451

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 30/76 (39%), Positives = 51/76 (67%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP+K      EV+++G+R+++ G QP  E+IQA+ D P P   +G++R IG VN
Sbjct: 553 EVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIQAIIDMPPPTDKEGVQRLIGTVN 612

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F++N A++Q P+
Sbjct: 613 YLDKFIQNKAEIQGPI 628


>SB_45779| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 946

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 32/80 (40%), Positives = 50/80 (62%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q + ++G+ I PAKC F    VT+LG+ +SADG      + + +  +P P+T++ LR F+
Sbjct: 198 QKLREHGLKIEPAKCQFFQSRVTYLGHAVSADGVSSDPAKTETVACWPTPRTLKELRSFL 257

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  +YYRRF+   A+  APL
Sbjct: 258 GFASYYRRFVPEFAQKAAPL 277



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 33/66 (50%), Positives = 39/66 (59%), Gaps = 3/66 (4%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIF---AL 176
           IDL  AY Q+ V P+D  KTA  +P GL+E+  M FGL NA  TFQR +  A IF    L
Sbjct: 112 IDLASAYNQVEVHPDDQPKTAFTSPIGLFEYVRMPFGLCNAPATFQRLM--ANIFRDDIL 169

Query: 177 RTLTTY 194
           R L  Y
Sbjct: 170 RILLVY 175


>SB_45108| Best HMM Match : RVT_1 (HMM E-Value=4.9e-37)
          Length = 1122

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 615 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVLDAPAPTNVTELRSFL 674

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 675 GMLQYYGKFLPNLSTLLHPLNNLL 698



 Score = 37.9 bits (84), Expect = 0.007
 Identities = 19/50 (38%), Positives = 28/50 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N +  G+ +A   FQ  ID
Sbjct: 531 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPCGVASAPAVFQSTID 580



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 705 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 749



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 584 KGIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 618


>SB_44757| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 789

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 321 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 380

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 381 GMLQYYGKFLPNLSTLLHPLNNLL 404



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 237 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 286



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE ++ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 411 SWLPECKQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 455



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 290 KGIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 324


>SB_38698| Best HMM Match : MiaE (HMM E-Value=5.8)
          Length = 284

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 31  ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 90

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 91  GMLQYYGKFLPNLSTLLHPLNNLL 114



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 3   DGVVCYIDDILITGRNDQEHKARLEAVLERLE 34


>SB_28642| Best HMM Match : RVT_1 (HMM E-Value=8.4e-39)
          Length = 1750

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 35/84 (41%), Positives = 50/84 (59%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 577 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 636

Query: 427 GMVNYYRRFLRNAAKLQAPLVNAI 498
           GM+ YY +FL N + L  PL N +
Sbjct: 637 GMLQYYGKFLPNLSTLLHPLNNLL 660



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 493 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 542



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L SA ++ H   N  + L  DAS   +GA
Sbjct: 667 SWLPECEQAFTSAKELLQSAKVLTHYDVNLPIKLACDASPYGIGA 711



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 546 KGIDGVVCYIDDILITGRNDREHKARLEAVLERLE 580


>SB_27381| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1392

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 32/83 (38%), Positives = 55/83 (66%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM
Sbjct: 323 LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRP-NLKELQAFLGM 381

Query: 433 VNYYRRFLRNAAKLQAPLVNAIV 501
           +NYY  ++ N   + +PL   +V
Sbjct: 382 LNYYACYIPNITTILSPLHQLLV 404



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 407 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 453


>SB_44297| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 824

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA---LKDFPLPQTVQGLR 417
           Q + ++GI + P+KC     EVTFLG+ +S +G +   E I+A   LKD P P+TV  +R
Sbjct: 605 QRLREHGIKLKPSKCKIFQREVTFLGHVVSEEGYRMDQESIKAVTDLKDTP-PKTVGEVR 663

Query: 418 RFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPV 570
           R +G+++Y+RR++ N A L AP+ + +   +   S +S    S   +  PV
Sbjct: 664 RLMGLLSYFRRYVHNFATLAAPIYDLLTEPKGGTSTKSKSRSSKSLSRQPV 714



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 24/69 (34%), Positives = 38/69 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRTL 185
           +D  +AY Q  +  +    TA +TP+GLYE+ ++  GL  A   FQR++ +  +  LR  
Sbjct: 519 LDQGRAYHQGFMGKDSRPLTAFVTPWGLYEWVHIPMGLSQAPAAFQRYMQDG-LEDLRDT 577

Query: 186 TTY*CIPVM 212
           T   CIP +
Sbjct: 578 T---CIPYL 583



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLR 310
           C  Y+DDI+V+S+   +H + LR + +RL+    + ++ + C +  R
Sbjct: 579 CIPYLDDIIVFSQSFEEHVSDLRKVLQRLR-EHGIKLKPSKCKIFQR 624



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 474 TSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSS 653
           TST S + R        P++W+ E +       D+++S  ++A+P       L TDAS  
Sbjct: 697 TSTKS-KSRSSKSLSRQPVSWSEEHQRILETLIDTITSPPVMAYPDYQQPFILHTDASER 755

Query: 654 HVGA 665
            +GA
Sbjct: 756 GLGA 759


>SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1020

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA---LKDFPLPQTVQGLR 417
           Q + ++GI + P+KC     EVTFLG+ +S +G +   E I+A   LKD P P+TV  +R
Sbjct: 205 QRLREHGIKLKPSKCKIFQREVTFLGHVVSEEGYRMDQESIKAVTDLKDTP-PKTVGEVR 263

Query: 418 RFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPV 570
           R +G+++Y+RR++ N A L AP+ + +   +   S +S    S   +  PV
Sbjct: 264 RLMGLLSYFRRYVHNFATLAAPIYDLLTEPKGGTSTKSKSRSSKSLSRQPV 314



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRTL 185
           +D  +AY Q  +  +    TA +TP+GLYE+  +  GL  A   FQR++ +  +  LR  
Sbjct: 119 LDQGRAYHQGFMGKDSRPLTAFVTPWGLYEWVRIPMGLSQAPAAFQRYMQDC-LEDLRDT 177

Query: 186 TTY*CIPVM 212
           T   CIP +
Sbjct: 178 T---CIPYL 183



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLR 310
           C  Y+DDI+V+S+   +H + LR + +RL+    + ++ + C +  R
Sbjct: 179 CIPYLDDIIVFSQSFEEHVSDLRKVLQRLR-EHGIKLKPSKCKIFQR 224



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 474 TSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSS 653
           TST S + R        P++W+ E +       D+++S  ++A+P       L TDAS  
Sbjct: 297 TSTKS-KSRSSKSLSRQPVSWSEEHQRILETLIDTITSPPVMAYPDYQQPFILHTDASER 355

Query: 654 HVGA 665
            +GA
Sbjct: 356 GLGA 359


>SB_24771| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 1387

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA---LKDFPLPQTVQGLR 417
           Q + ++GI + P+KC     EVTFLG+ +S +G +   E I+A   LKD P P+TV  +R
Sbjct: 298 QRLREHGIKLKPSKCKIFQREVTFLGHVVSEEGYRMDQESIKAVTDLKDTP-PKTVGEVR 356

Query: 418 RFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPV 570
           R +G+++Y+RR++ N A L AP+ + +   +   S +S    S   +  PV
Sbjct: 357 RLMGLLSYFRRYVHNFATLAAPIYDLLTEPKGGTSTKSKSRSSKSLSRQPV 407



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRTL 185
           +D  +AY Q  +  +    TA +TP+GLYE+  +  GL  A   FQR++ +  +  LR  
Sbjct: 212 LDQGRAYHQGFMGKDSRPLTAFVTPWGLYEWVRIPMGLSQAPAAFQRYMQDC-LEDLRDT 270

Query: 186 TTY*CIPVM 212
           T   CIP +
Sbjct: 271 T---CIPYL 276



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 14/47 (29%), Positives = 29/47 (61%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLR 310
           C  Y+DDI+V+S++  +H + LR + +RL+    + ++ + C +  R
Sbjct: 272 CIPYLDDIIVFSQNFEEHVSDLRKVLQRLR-EHGIKLKPSKCKIFQR 317



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 474 TSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSS 653
           TST S + R        P++W+ E +       D+++S  ++A+P       L TDAS  
Sbjct: 390 TSTKS-KSRSSKSLSRQPVSWSEEHQRILETLIDTITSPPVMAYPDYQQPFILHTDASER 448

Query: 654 HVGA 665
            +GA
Sbjct: 449 GLGA 452


>SB_1761| Best HMM Match : ERF (HMM E-Value=6.8)
          Length = 299

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA---LKDFPLPQTVQGLR 417
           Q + ++GI + P+KC     EVTFLG+ +S +G +   E I+A   LKD P P+TV  +R
Sbjct: 39  QRLREHGIKLKPSKCKIFQREVTFLGHVVSEEGYRMDQESIKAVTDLKDTP-PKTVGEVR 97

Query: 418 RFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPV 570
           R +G+++Y+RR++ N A L AP+ + +   +   S +S    S   +  PV
Sbjct: 98  RLMGLLSYFRRYVHNFATLAAPIYDLLTEPKGGTSTKSKNRSSKSLSRQPV 148



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLR 310
           C  Y+DDI+V+S+   +H + LR + +RL+    + ++ + C +  R
Sbjct: 13  CIPYLDDIIVFSQSFEEHVSDLRKVLQRLR-EHGIKLKPSKCKIFQR 58



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 18/64 (28%), Positives = 31/64 (48%)
 Frame = +3

Query: 474 TSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSS 653
           TST S ++R        P++W+   +       D+++S  ++A+P       L TDAS  
Sbjct: 131 TSTKS-KNRSSKSLSRQPVSWSEGHQRILETLIDTITSPPVMAYPDYQQPFILHTDASER 189

Query: 654 HVGA 665
            +GA
Sbjct: 190 GLGA 193


>SB_42440| Best HMM Match : RnaseH (HMM E-Value=0.9)
          Length = 348

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA---LKDFPLPQTVQGLR 417
           Q + ++GI + P+KC     EVTFLG+ +S +G +   E I+A   LKD P P+TV  +R
Sbjct: 52  QRLREHGIKLKPSKCKIFQREVTFLGHVVSEEGYRMDQESIKAVTDLKDTP-PKTVGEVR 110

Query: 418 RFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPV 570
           R +G+++Y+RR++ N A L AP+ + +   +   S +S    S   +  PV
Sbjct: 111 RLMGLLSYFRRYVHNFATLAAPIYDLLTEPKGGTSTKSKSRSSKSLSRQPV 161



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLR 310
           C  Y+DDI+V+S+   +H + LR + +RL+    + ++ + C +  R
Sbjct: 26  CIPYLDDIIVFSQSFEEHVSDLRKVLQRLR-EHGIKLKPSKCKIFQR 71



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 474 TSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSS 653
           TST S + R        P++W+ E +       D+++S  ++A+P       L TDAS  
Sbjct: 144 TSTKS-KSRSSKSLSRQPVSWSEEHQRILETLIDTITSPPVMAYPDYQQPFILHTDASER 202

Query: 654 HVGA 665
            +GA
Sbjct: 203 GLGA 206


>SB_13410| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1984

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA---LKDFPLPQTVQGLR 417
            Q + ++GI + P+KC     EVTFLG+ +S +G +   E I+A   LKD P P+TV  +R
Sbjct: 697  QRLREHGIKLKPSKCKIFQREVTFLGHVVSEEGYRMDQESIKAVTDLKDTP-PKTVGEVR 755

Query: 418  RFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPV 570
            R +G+++Y+RR++ N A L AP+ + +   +   S +S    S   +  PV
Sbjct: 756  RLMGLLSYFRRYVHNFATLAAPIYDLLTEPKGGTSTKSKSRSSKSLSRQPV 806



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRTL 185
           +D  +AY Q  +  +    TA +TP+GLYE+  +  GL  A   FQR++ +  +  LR  
Sbjct: 611 LDQGRAYHQGFMGKDSRPLTAFVTPWGLYEWVRIPMGLSQAPAAFQRYMQDC-LEDLRDT 669

Query: 186 TTY*CIPVM 212
           T   CIP +
Sbjct: 670 T---CIPYL 675



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLR 310
           C  Y+DDI+V+S+   +H + LR + +RL+    + ++ + C +  R
Sbjct: 671 CIPYLDDIIVFSQSFEEHVSDLRKVLQRLR-EHGIKLKPSKCKIFQR 716



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 474 TSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSS 653
           TST S + R        P++W+ E +       D+++S  ++A+P       L TDAS  
Sbjct: 789 TSTKS-KSRSSKSLSRQPVSWSEEHQRILETLIDTITSPPVMAYPDYQQPFILHTDASER 847

Query: 654 HVGA 665
            +GA
Sbjct: 848 GLGA 851


>SB_3438| Best HMM Match : RVT_1 (HMM E-Value=1.3e-30)
          Length = 1405

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 34/78 (43%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +N  KC F  P V FLG+ I   G +P   + +A+K FP PQTV  L+RF+GM
Sbjct: 443 LQEAGVTLNE-KCEFSKPSVKFLGHIIDHSGVRPDPAKTEAIKSFPTPQTVSDLQRFMGM 501

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN   +FL + A L  PL
Sbjct: 502 VNQMGKFLPSLANLNEPL 519



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + Q+ +  E    T  ITP+G + FN + FG+ +A + +QR
Sbjct: 357 LDTNSGFWQLQLDKESRLLTTFITPYGRFCFNRVPFGICSAPEVYQR 403



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           D    ++DD LVY     QH   LR + +RL+
Sbjct: 413 DGVICHIDDTLVYGETQEQHDTRLREVLRRLQ 444


>SB_53979| Best HMM Match : TetR_C (HMM E-Value=5.3)
          Length = 327

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 43  GLTAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYY 102

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 103 QKFLPNLSQVLQPL 116



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y DDILV  RD+ +H  +L  + +RL     L  Q+  C
Sbjct: 14  YQDDILVTGRDSEEHLTNLEEVLRRLH-ANGLTAQREKC 51


>SB_37892| Best HMM Match : rve (HMM E-Value=2.1e-16)
          Length = 824

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 34/78 (43%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +N  KC F  P V FLG+ I   G +P   + +A+K FP PQTV  L+RF+GM
Sbjct: 285 LQEAGVTLNE-KCEFSKPFVKFLGHIIDQSGVRPDPAKTEAIKSFPTPQTVNDLQRFMGM 343

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN   +FL + A L  PL
Sbjct: 344 VNLMGKFLPSLANLNEPL 361



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + Q+P+  E       ITP+G + FN + FG+ +A + +QR
Sbjct: 199 LDANSGFWQLPLDKESRLLHTFITPYGRFCFNRVPFGICSAPEVYQR 245



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 13/43 (30%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W    ++ F   K+ L+S+  +AH  PN    + +DAS+  +G
Sbjct: 373 WGESQQQSFTRIKEKLTSSRSLAHYDPNRPTIVSSDASNLGIG 415


>SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 766

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 55  GLTAQREKCEFMQPSLKYLGHVIDKDGIHPASDKVEAIKTAPSPQDVTQLRAFLGLVNYY 114

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 115 QKFLPNLSQVLQPL 128



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +2

Query: 185 DDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           DDILV  RD+ +H  +L  + +RL     L  Q+  C
Sbjct: 28  DDILVTGRDSEEHLTNLEEVLRRLH-ANGLTAQREKC 63


>SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38)
          Length = 1084

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 601 GLTAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYY 660

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 661 QKFLPNLSQVLQPL 674



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL KAY QIP+       T + T  GLY +N + FG+ ++   FQR +D
Sbjct: 511 LDLTKAYSQIPLDDSAKQFTTLTTHKGLYAYNRLPFGVASSAAIFQRQMD 560



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y DDILV  RD+ +H  +L  + +RL     L  Q+  C
Sbjct: 572 YQDDILVTGRDSEEHLTNLEEVLRRLH-ANGLTAQREKC 609


>SB_29623| Best HMM Match : GM_CSF (HMM E-Value=5)
          Length = 296

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 22  GLTAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYY 81

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 82  QKFLPNLSQVLQPL 95


>SB_27267| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17)
          Length = 649

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 29/77 (37%), Positives = 48/77 (62%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 569 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 628

Query: 439 YYRRFLRNAAKLQAPLV 489
           Y  +F+ + A LQ P+V
Sbjct: 629 YLDKFIEHKADLQGPIV 645



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 481 TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 531


>SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38)
          Length = 1122

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 635 GLTAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYY 694

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 695 QKFLPNLSQVLQPL 708



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL KAY QIP+       T + T  GLY +N + FG+ ++   FQR +D
Sbjct: 545 LDLTKAYSQIPLDDSAKQFTTLTTHKGLYAYNRLPFGVASSAAIFQRQMD 594



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y DDILV  RD+ +H  +L  + +RL     L  Q+  C
Sbjct: 606 YQDDILVTGRDSEEHLTNLEEVLRRLH-ANGLTAQREKC 643


>SB_9562| Best HMM Match : TetR_C (HMM E-Value=4)
          Length = 242

 Score = 72.1 bits (169), Expect = 4e-13
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 73  GLTAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYY 132

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 133 QKFLPNLSQVLQPL 146



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y DDILV  RD+ +H  +L  + +RL     L  Q+  C
Sbjct: 44  YQDDILVTGRDSEEHLTNLEEVLRRLH-ANGLTAQREKC 81



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +3

Query: 63  TAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T + T  GLY +N + FG+ ++   FQR +D
Sbjct: 2   TTLTTHKGLYAYNRLPFGVASSAAIFQRQMD 32


>SB_58675| Best HMM Match : RVT_1 (HMM E-Value=0)
          Length = 2353

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 39/111 (35%), Positives = 65/111 (58%), Gaps = 3/111 (2%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA---LKDFPLPQTVQGLR 417
            Q + ++GI + P+KC     EVTFLG+ ++ +G +   E I+A   LKD P P+TV  +R
Sbjct: 1142 QRLREHGIKLKPSKCKIFQREVTFLGHVVAEEGYRMDQESIKAVTDLKDTP-PKTVGEVR 1200

Query: 418  RFIGMVNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPV 570
            R +G+++Y+RR++ N A L AP+ + +   +   S +S    S   +  PV
Sbjct: 1201 RLMGLLSYFRRYVHNFATLAAPIYDLLTEPKGGTSTKSKSRSSKSLSRQPV 1251



 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 20/50 (40%), Positives = 33/50 (66%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLP 396
            Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P
Sbjct: 1938 QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGVKLSDKRVEAIVEAPAP 1987



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRTL 185
            +D  +AY Q  +  +    TA +TP+GLYE+  +  GL  A   FQR++ +  +  LR  
Sbjct: 1056 LDQGRAYHQGFMGKDSRPLTAFVTPWGLYEWVRIPMGLSQAPAAFQRYMQDC-LEDLRDT 1114

Query: 186  TTY*CIPVM 212
            T   CIP +
Sbjct: 1115 T---CIPYL 1120



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 14/47 (29%), Positives = 28/47 (59%)
 Frame = +2

Query: 170  CFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLVLLR 310
            C  Y+DDI+V+S+   +H + LR + +RL+    + ++ + C +  R
Sbjct: 1116 CIPYLDDIIVFSQSFEEHVSDLRKVLQRLR-EHGIKLKPSKCKIFQR 1161



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 19/64 (29%), Positives = 31/64 (48%)
 Frame = +3

Query: 474  TSTASQRDRGH*GKGLTPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSS 653
            TST S + R        P++W+ E +       D+++S  ++A+P       L TDAS  
Sbjct: 1234 TSTKS-KSRSSKSLSRQPVSWSEEHQRILETLIDTITSPPVMAYPDYQQPFILHTDASER 1292

Query: 654  HVGA 665
             +GA
Sbjct: 1293 GLGA 1296


>SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18)
          Length = 1052

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 29/76 (38%), Positives = 51/76 (67%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP+K      EV+++G+R+++ G QP  E+I+A+ D P P   +G++R IG VN
Sbjct: 345 EVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAIIDMPPPTDKEGVQRLIGTVN 404

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F++N A++Q P+
Sbjct: 405 YLDKFIQNKAEIQGPI 420


>SB_17208| Best HMM Match : RVT_1 (HMM E-Value=6.4e-19)
          Length = 1053

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 29/76 (38%), Positives = 51/76 (67%)
 Frame = +1

Query: 259  DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
            + G+  NP+K      EV+++G+R+++ G QP  E+I+A+ D P P   +G++R IG VN
Sbjct: 831  EVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAIIDMPPPTDKEGVQRLIGTVN 890

Query: 439  YYRRFLRNAAKLQAPL 486
            Y  +F++N A++Q P+
Sbjct: 891  YLDKFIQNKAEIQGPI 906



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + Q+PV           TP+G Y F  + FG+  A + +QR
Sbjct: 744 LDACSGFWQLPVDKASSKLLTFNTPWGRYRFCRLPFGVAPAPEIYQR 790


>SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1052

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 29/76 (38%), Positives = 51/76 (67%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP+K      EV+++G+R+++ G QP  E+I+A+ D P P   +G++R IG VN
Sbjct: 345 EVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAIIDMPPPTDKEGVQRLIGTVN 404

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F++N A++Q P+
Sbjct: 405 YLDKFIQNKAEIQGPI 420


>SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015)
          Length = 797

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 31/74 (41%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 490 GLTAQREKCEFMQPPLKYLGHIIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYY 549

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 550 QKFLPNLSQVLQPL 563



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 179 YVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           Y DDILV  RD+ +H  +L  + +RL     L  Q+  C
Sbjct: 461 YQDDILVTGRDSEEHLTNLEEVLRRLH-ANGLTAQREKC 498



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 14/37 (37%), Positives = 20/37 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFG 116
           +DL KAY QIP+       T + T  GLY+ + +  G
Sbjct: 433 LDLTKAYSQIPLDDSAKQFTTLTTHKGLYQDDILVTG 469


>SB_27075| Best HMM Match : rve (HMM E-Value=1.5e-16)
          Length = 656

 Score = 71.7 bits (168), Expect = 5e-13
 Identities = 29/76 (38%), Positives = 51/76 (67%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP+K      EV+++G+R+++ G QP  E+I+A+ D P P   +G++R IG VN
Sbjct: 40  EVGLKFNPSKVKLRVDEVSYVGHRLTSQGLQPDPEKIKAVIDMPPPTDKEGVQRLIGTVN 99

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F++N A++Q P+
Sbjct: 100 YLDKFIKNKAEIQGPI 115


>SB_51200| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 938

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 297 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 356

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 357 YLDKFIEHKADLQGPI 372



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 209 TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 259


>SB_2895| Best HMM Match : RnaseH (HMM E-Value=3.1)
          Length = 342

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 84  EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 143

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 144 YLDKFIEHKADLQGPI 159



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 3   FWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 46


>SB_47235| Best HMM Match : RVT_1 (HMM E-Value=4.5e-17)
          Length = 378

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 166 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 225

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 226 YLDKFIEHKADLQGPI 241



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 78  TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 128


>SB_42289| Best HMM Match : RVT_1 (HMM E-Value=5.2e-17)
          Length = 429

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 251 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 310

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 311 YLDKFIEHKADLQGPI 326



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 16/51 (31%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+P+  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 163 TLDACSGFWQLPIDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 213


>SB_34611| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 875

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 166 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 225

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 226 YLDKFIEHKADLQGPI 241



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 78  TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 128


>SB_27043| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 226

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 107 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 166

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 167 YLDKFIEHKADLQGPI 182



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 19  TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 69


>SB_25628| Best HMM Match : RVT_1 (HMM E-Value=0.17)
          Length = 526

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 212 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 271

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 272 YLDKFIEHKADLQGPI 287


>SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1696

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 30/67 (44%), Positives = 45/67 (67%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY++FL N 
Sbjct: 685 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYYQKFLPNL 744

Query: 466 AKLQAPL 486
           +++  PL
Sbjct: 745 SQVLQPL 751



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
            +DL KAY QIP+       T + T  GLY +N + FG+ ++   FQR +D
Sbjct: 1263 LDLTKAYSQIPLDDSAKQFTTLTTHKGLYAYNRLPFGVASSAAIFQRQMD 1312


>SB_13654| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1451

 Score = 70.5 bits (165), Expect = 1e-12
 Identities = 28/76 (36%), Positives = 52/76 (68%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP+K      +V+++G+R+++ G QP  E+I+A+ D P P+  +G++R IG VN
Sbjct: 500 EVGLKFNPSKVKLRVDKVSYVGHRLTSQGLQPDPEKIKAVIDMPPPRDKEGVQRLIGTVN 559

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F++N A++Q P+
Sbjct: 560 YLDKFIQNKAEIQGPI 575


>SB_51018| Best HMM Match : RVT_1 (HMM E-Value=5.8e-17)
          Length = 635

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 28/74 (37%), Positives = 46/74 (62%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VNY 
Sbjct: 347 GLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVNYL 406

Query: 445 RRFLRNAAKLQAPL 486
            +F+ + A LQ P+
Sbjct: 407 DKFIEHKADLQGPI 420



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 257 TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 307


>SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051)
          Length = 522

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 30/74 (40%), Positives = 46/74 (62%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++ +K  P PQ V  LR F+G+VNYY
Sbjct: 319 GLTAQREKCEFMQPSLKYLGHVIDKDGIHPASDKLETIKTAPSPQDVTQLRAFLGLVNYY 378

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 379 QKFLPNLSQVLQPL 392


>SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14)
          Length = 1217

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 30/74 (40%), Positives = 47/74 (63%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNY+
Sbjct: 408 GLTAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYH 467

Query: 445 RRFLRNAAKLQAPL 486
           ++FL N +++  PL
Sbjct: 468 QKFLPNLSQVLQPL 481



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 20/50 (40%), Positives = 28/50 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL KAY QIP+       T + T  GLY  N + FG+ ++   FQR +D
Sbjct: 322 LDLTKAYSQIPLDDSAKQFTTLTTHKGLYACNRLPFGVASSAAIFQRQMD 371


>SB_50204| Best HMM Match : rve (HMM E-Value=6.6e-22)
          Length = 800

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 28/76 (36%), Positives = 46/76 (60%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG  P  E+++A+ + P P    G+ RF+G VN
Sbjct: 345 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLXPDPEKVRAINEMPAPTDKDGILRFLGTVN 404

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 405 YLDKFIEHKADLQGPI 420



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 257 TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 307


>SB_8572| Best HMM Match : RVT_1 (HMM E-Value=5.6e-17)
          Length = 1432

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 27/76 (35%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VN
Sbjct: 513 EIGLKFNPRKAKLRVPEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVN 572

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +++ + A LQ P+
Sbjct: 573 YLDKYIEHKADLQGPI 588



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    + Q+PV  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 425 TLDACSGFWQLPVDEESSKLLTFNTPWGRYRFLRLPFGISSAPEIYQREMD 475


>SB_3041| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 939

 Score = 69.3 bits (162), Expect = 3e-12
 Identities = 33/80 (41%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 239 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISGDGVEADPEKTKAIQDFPRPTTVTELQRFN 297

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVN   +F+ + A +  PL
Sbjct: 298 GMVNQLAKFIPDLATINKPL 317



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 155 LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNLLPFGISSAPEIFQR 201



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W    E  F A K  L+S  ++AH  PN    +  DA    +GA
Sbjct: 329 WDQPQERAFQAIKTKLTSTDVLAHYDPNKRSIVAADACQDGLGA 372


>SB_58669| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3038

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 33/80 (41%), Positives = 49/80 (61%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 2392 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRFN 2450

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            GMVN   +F+ + A +  PL
Sbjct: 2451 GMVNQLAKFIPDLATINEPL 2470



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 2308 LDANSGFWQIPLDEESRLLTIFVTPFGRYCFNRLPFGISSAPEIFQR 2354


>SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 918

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 30/74 (40%), Positives = 46/74 (62%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+     KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY
Sbjct: 456 GLTAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYY 515

Query: 445 RRFLRNAAKLQAPL 486
           ++ L N +++  PL
Sbjct: 516 QKSLPNLSQVLQPL 529



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL KAY QIP+       T + T  GLY +N + FG+ ++   FQR +D
Sbjct: 373 LDLTKAYFQIPLDDSAKQFTTLTTHKGLYAYNRLPFGIASSAAIFQRQMD 422


>SB_46544| Best HMM Match : DUF1539 (HMM E-Value=6.2)
          Length = 186

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 33/80 (41%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 37  QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRFN 95

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVN   +F+ + A +  PL
Sbjct: 96  GMVNQLAKFIPDLATINEPL 115


>SB_37340| Best HMM Match : DUF1539 (HMM E-Value=8.4)
          Length = 209

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 33/80 (41%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 37  QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRFN 95

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVN   +F+ + A +  PL
Sbjct: 96  GMVNQLAKFIPDLATINEPL 115



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W    E  F A K  L+S  ++AH  PN    +  DA    +GA
Sbjct: 127 WDQPQERAFQAIKTKLTSTDVLAHYDPNKRSIVAADACQDGLGA 170


>SB_33095| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 833

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 33/80 (41%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 160 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRFN 218

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVN   +F+ + A +  PL
Sbjct: 219 GMVNQLAKFIPDLATINEPL 238



 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 76  LDANSGFWQIPLDEESRLLTIFVTPFGRYCFNRLPFGISSAPEIFQR 122


>SB_31771| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1963

 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 33/80 (41%), Positives = 49/80 (61%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 1263 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRFN 1321

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            GMVN   +F+ + A +  PL
Sbjct: 1322 GMVNQLAKFIPDLATINEPL 1341



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 1179 LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 1225



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            W    E  F A K  L+S  ++AH  PN    +  DA    +GA
Sbjct: 1353 WDQPQERAFQAIKTKLTSTDVLAHYDPNKRSIVAADACQDGLGA 1396


>SB_58536| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 301

 Score = 67.7 bits (158), Expect = 8e-12
 Identities = 32/80 (40%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ ++++DFP P TV  L+RF 
Sbjct: 80  QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKSIQDFPRPTTVTELQRFN 138

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVN   +F+ + A +  PL
Sbjct: 139 GMVNQLAKFIPDLATINEPL 158



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           + + P+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 2   FGKYPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 42



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 14/44 (31%), Positives = 20/44 (45%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W    E  F A K  ++S  ++AH  PN    +  DA    +GA
Sbjct: 170 WDQPQERAFQAIKTKMTSTDVLAHYDPNKRSIVAADACQDGLGA 213


>SB_58015| Best HMM Match : rve (HMM E-Value=0.00087)
          Length = 1333

 Score = 67.7 bits (158), Expect = 8e-12
 Identities = 30/73 (41%), Positives = 48/73 (65%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I  N  K      +V +LGN ++ADG +P  E+I+A+K+ P P+T Q L+R +GMVNY  
Sbjct: 480 IRFNSDKIQLRVNQVKYLGNIVTADGFKPDPEKIKAIKEMPQPETKQDLQRLLGMVNYLS 539

Query: 448 RFLRNAAKLQAPL 486
           +++ N +++ APL
Sbjct: 540 QYIPNMSEITAPL 552


>SB_24280| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1351

 Score = 67.7 bits (158), Expect = 8e-12
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           +V+     +  APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM+NYY 
Sbjct: 592 VVVRIDDILIAAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGMLNYYA 651

Query: 448 RFLRNAAKLQAPLVNAIV 501
            ++ N   + +PL   +V
Sbjct: 652 CYIPNITTILSPLHQLLV 669



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL +AYQQ+ +  E    T I T  GL+E+N + +G+ +A   FQR ++
Sbjct: 534 LDLSQAYQQLELDEESKKYTTITTHKGLFEYNRLCYGIASAPGIFQRTME 583



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 672 TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 718


>SB_53144| Best HMM Match : RVT_thumb (HMM E-Value=0.14)
          Length = 272

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 30/73 (41%), Positives = 48/73 (65%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I  N  K      +V +LGN ++ADG +P  E+I+A+K+ P P+T Q L+R +GMVNY  
Sbjct: 59  IRFNRDKIQLRVNQVKYLGNIVTADGFKPDPEKIKAIKEMPQPETKQDLQRLLGMVNYLS 118

Query: 448 RFLRNAAKLQAPL 486
           +++ N +++ APL
Sbjct: 119 QYIPNMSEITAPL 131


>SB_41075| Best HMM Match : RVT_1 (HMM E-Value=2.1e-30)
          Length = 1152

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 33/109 (30%), Positives = 59/109 (54%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +E  G+ +N  KC F    VTFLG+ + +DG +P   +I+A+ D   P+ +  LRRF+GM
Sbjct: 576 LESAGVTLNIGKCEFSKNRVTFLGHVVDSDGVRPDPTKIKAIADMKEPKDIHELRRFLGM 635

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPVKIA 579
            N   +F    A+   PL   +++T+ ++  +    L+  NA +   ++
Sbjct: 636 TNQLGKFSSKLAEASKPL-RDLLSTKNEILCKDATVLAHYNAQLKTSVS 683



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP++ E    T  ITPFG + +N + FG+ +A + FQ+
Sbjct: 490 LDANSGFHQIPLSKESTLLTTFITPFGRFCYNRLPFGITSAPEHFQK 536



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +2

Query: 182 VDDILVYSRDALQHAAHLRTLFKRLK 259
           +DD LVY RD  +H   L  + K+L+
Sbjct: 552 IDDTLVYGRDQQEHDERLERVLKKLE 577


>SB_18330| Best HMM Match : rve (HMM E-Value=1.2e-16)
          Length = 997

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 28/80 (35%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q   + G+ +N  K   G  E+ +LG+ ++ DG +P  ++++A+++ P P  V+G+RRF 
Sbjct: 345 QRCRERGVKLNKKKLQKGCEEIPYLGHVLTRDGLKPDPDKVKAVQEMPQPTDVKGVRRFC 404

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G VNY  +FL N A +  P+
Sbjct: 405 GFVNYLAKFLPNLASVIGPI 424



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 13/52 (25%), Positives = 25/52 (48%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +D    Y  + +  E I  T    PFG + +  + FG+  + + FQ+ + +A
Sbjct: 255 VDARNGYWHVQLDDESIKLTTFDMPFGRFAWKRLPFGISVSSEMFQKKLTQA 306


>SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34)
          Length = 837

 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 29/67 (43%), Positives = 44/67 (65%)
 Frame = +1

Query: 286 KCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNA 465
           KC F  P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY++ L N 
Sbjct: 286 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFLGLVNYYQKSLPNL 345

Query: 466 AKLQAPL 486
           +++  PL
Sbjct: 346 SQVLQPL 352


>SB_53148| Best HMM Match : rve (HMM E-Value=4.8e-21)
          Length = 1329

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 636 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 695

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 696 YLDKFIEHKADLQGPI 711



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 548 TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 598


>SB_47242| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)
          Length = 450

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 326 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 385

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 386 YLDKFIEHKADLQGPI 401



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 238 TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 288


>SB_44206| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 770

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 166 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 225

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 226 YLDKFIEHKADLQGPI 241



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 78  TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 128


>SB_41052| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 732

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 33/82 (40%), Positives = 49/82 (59%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           S Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP   TV  L+R
Sbjct: 594 SVQRLKDVGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPQHTTVTELQR 652

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
           F GMVN   +F+ + A +  PL
Sbjct: 653 FNGMVNQLAKFIPDLATINEPL 674



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 539 LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 585


>SB_31616| Best HMM Match : rve (HMM E-Value=6.9e-21)
          Length = 1183

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 475 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 534

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 535 YLDKFIEHKADLQGPI 550



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 387 TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRVPFGISSAPEIYQREMD 437


>SB_28476| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19)
          Length = 332

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 251 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 310

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 311 YLDKFIEHKADLQGPI 326



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 163 TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 213


>SB_24272| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)
          Length = 1197

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 489 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 548

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 549 YLDKFIEHKADLQGPI 564



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 401 TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 451


>SB_20593| Best HMM Match : RnaseH (HMM E-Value=1.9)
          Length = 341

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 10  EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 69

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 70  YLDKFIEHKADLQGPI 85


>SB_50912| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)
          Length = 302

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 166 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 225

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 226 YLDKFIEHKADLQGPI 241



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 78  TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 128


>SB_22228| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)
          Length = 302

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 166 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 225

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 226 YLDKFIEHKADLQGPI 241



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 78  TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 128


>SB_10467| Best HMM Match : zf-PARP (HMM E-Value=5.6e-35)
          Length = 1311

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 25/76 (32%), Positives = 48/76 (63%)
 Frame = +1

Query: 259  DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
            + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 890  EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 949

Query: 439  YYRRFLRNAAKLQAPL 486
            Y  +F+ + A LQ P+
Sbjct: 950  YLDKFIEHKADLQGPI 965


>SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1821

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 33/74 (44%), Positives = 47/74 (63%)
 Frame = +1

Query: 265  GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
            GI +N  KC F   ++ FLG+ IS  G +   E+ +A++DFP P TV+ L+RF GMVN  
Sbjct: 1305 GITLND-KCEFSKHKIKFLGHIISEKGVEADPEKNKAIQDFPRPNTVKELQRFNGMVNQL 1363

Query: 445  RRFLRNAAKLQAPL 486
             +FL + AK+  PL
Sbjct: 1364 AKFLPDLAKINEPL 1377


>SB_2465| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 698

 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 24/76 (31%), Positives = 48/76 (63%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PE++++G+  +++G +P  E+++A+ + P P    G++RF+G +N
Sbjct: 208 EVGLKFNPKKIKLRVPEISYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTIN 267

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 268 YLDKFIEHKADLQGPI 283



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+    E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 120 TLDACSGYWQVEGDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 170


>SB_8440| Best HMM Match : RVT_1 (HMM E-Value=4.3e-18)
          Length = 878

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 26/64 (40%), Positives = 47/64 (73%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPL 486
           +V +LGN ++ADG +P  E+I+A+K+ P P+T Q L+R +GMVNY  +++ N +++  PL
Sbjct: 778 QVKYLGNIVTADGFKPDPEKIKAIKEMPQPKTKQDLQRLLGMVNYLSQYIPNMSEITTPL 837

Query: 487 VNAI 498
           ++ +
Sbjct: 838 MSLL 841



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 15/51 (29%), Positives = 24/51 (47%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           ID+   Y    +  E        TPFG ++F+ M FG+  A    Q+ +D+
Sbjct: 674 IDMSNCYWHKKLDEESSYLCTFNTPFGRHKFDRMPFGISVAADVAQKMVDD 724



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/51 (29%), Positives = 24/51 (47%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           ID+   Y    +  E        TPFG ++F+ M FG+  A    Q+ +D+
Sbjct: 343 IDMSNCYWHKKLDEESSYLCTFNTPFGRHKFDRMPFGISVAADGAQKMVDD 393


>SB_5251| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 945

 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 29/78 (37%), Positives = 46/78 (58%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + + G+ +NP KC FG   +TFLG+ IS +G      +++A+ +   P  V  LR F+G+
Sbjct: 316 LSESGLTLNPGKCQFGLSSITFLGHVISDNGVSADPGKVEAIVNARAPMNVSELRGFLGL 375

Query: 433 VNYYRRFLRNAAKLQAPL 486
           V Y  R++ + A L APL
Sbjct: 376 VQYVGRYIPDLATLSAPL 393


>SB_22156| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1551

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 862  QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGVKLSDKRVEAIVEAPAPTNQSEVRSFL 921

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            G   +  +F+   A + APL
Sbjct: 922  GSAQFCAKFIPQFATISAPL 941



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL  A+ QI ++PE    T    P GLY +  + FG+  A + FQ  I
Sbjct: 778 LDLNMAFHQIELSPESRDITTFAAPTGLYRYCRLLFGVNMATEKFQNLI 826


>SB_19382| Best HMM Match : rve (HMM E-Value=8.4e-26)
          Length = 684

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 29/78 (37%), Positives = 44/78 (56%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +E  G+ +N  KC F    VTFLG+ + +DG +P   +I+A+ D   P+ +  LRRF+GM
Sbjct: 26  LESAGVTLNRDKCEFSKNRVTFLGHVVDSDGVRPDPTKIKAIADMKEPKDIHELRRFLGM 85

Query: 433 VNYYRRFLRNAAKLQAPL 486
            N   +F    A+   PL
Sbjct: 86  ANQLGKFSSKLAEASKPL 103



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 12/38 (31%), Positives = 22/38 (57%)
 Frame = +2

Query: 182 VDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           +DD LVY RD  +H   L  + K+L+ +  + + ++ C
Sbjct: 2   IDDTLVYGRDQQEHDERLERVLKKLE-SAGVTLNRDKC 38


>SB_1416| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37)
          Length = 857

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 4/127 (3%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + I++ G+ +N  KC F   E+++ G+ I+  G  P  E+++A+K    P+ V  LR+
Sbjct: 537 TLKIIKESGLKLNKEKCEFRKKEISYFGHVINQQGISPNPEKVRAIKALAAPENVSELRQ 596

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVATEV----KVSHRSLGHLSSKNALMPVKIACHL 588
             GM+NY  +FL N + + AP+ + + +  V    +V   +   +    +  PV+ A  +
Sbjct: 597 VTGMINYLGKFLPNLSTVMAPMNDLLKSDTVWQWTEVQQEAFDKVKEMVSTTPVEFA--V 654

Query: 589 QLWWHTL 609
           +  W+ L
Sbjct: 655 ETAWYRL 661



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  ITP G + F  + FG+  A + FQR
Sbjct: 455 LDASSGFWQIPLTDESAKLTTFITPQGRFCFRRLPFGITVAPEIFQR 501


>SB_51031| Best HMM Match : RVT_1 (HMM E-Value=1.8e-37)
          Length = 858

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 4/127 (3%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + I++ G+ +N  KC F   E+++ G+ I+  G  P  E+++A+K    P+ V  LR+
Sbjct: 538 TLKIIKESGLKLNKEKCEFRKKEISYFGHVINQQGISPNPEKVRAIKALAAPENVSELRQ 597

Query: 421 FIGMVNYYRRFLRNAAKLQAPLVNAIVATEV----KVSHRSLGHLSSKNALMPVKIACHL 588
             GM+NY  +FL N + + AP+ + + +  V    +V   +   +    +  PV+ A  +
Sbjct: 598 VTGMINYLGKFLPNLSTVMAPMNDLLKSDTVWQWTEVQQEAFDKVKEMVSTTPVEFA--V 655

Query: 589 QLWWHTL 609
           +  W+ L
Sbjct: 656 ETAWYRL 662



 Score = 34.7 bits (76), Expect = 0.070
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  ITP G + F  + FG+  A + FQR
Sbjct: 456 LDASSGFWQIPLTDESAKLTTFITPQGRFCFRRLPFGITVAPEIFQR 502


>SB_50945| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 896

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 101 QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKRVEAIVEAPAPTNQSEVRSFL 160

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 161 GSAQFCAKFIPQFATISAPL 180



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL  A+ QI ++PE    T    P GLY +  + FG+  A + FQ  I
Sbjct: 17  LDLNMAFHQIELSPESRDITTFAAPTGLYRYCRLLFGVNMATEKFQNLI 65


>SB_50857| Best HMM Match : RVT_1 (HMM E-Value=9.8e-33)
          Length = 829

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 31/80 (38%), Positives = 48/80 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP   TV  L+RF 
Sbjct: 312 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRHTTVTELQRFN 370

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GM+N   +F+ + A +  PL
Sbjct: 371 GMINQLAKFIPDLATINEPL 390



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 228 LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 274



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/44 (34%), Positives = 20/44 (45%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W    E  F A K  L+S  ++AH  PN    +  DA    +GA
Sbjct: 402 WDQPQERAFQAIKTRLTSTDVLAHYDPNKRSIVAADACQDGLGA 445


>SB_40370| Best HMM Match : rve (HMM E-Value=1.3e-37)
          Length = 1393

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 672 QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKRVEAIVEAPAPTNQSEVRSFL 731

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 732 GSAQFSAKFIPQFATISAPL 751



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL  A+ QI ++PE    T    P GLY +  + FG+  A + FQ  I
Sbjct: 588 LDLNMAFHQIELSPESRDITTFAAPTGLYRYCRLLFGVNMATEKFQNLI 636


>SB_29850| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 219

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 46  QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKRVEAIVEAPAPTNQSEVRSFL 105

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 106 GSAQFCAKFIPQFATISAPL 125


>SB_22266| Best HMM Match : Dimerisation (HMM E-Value=4.3)
          Length = 290

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 32  QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKRVEAIVEAPAPTNQSEVRSFL 91

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 92  GSAQFCAKFIPQFATISAPL 111


>SB_49941| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 469

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 29/80 (36%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q   + G+ +N  K      EV F+G+ IS++G +P   ++Q +K+ P P   Q ++R +
Sbjct: 218 QRCREKGVKLNREKLKLRCSEVDFMGHVISSNGLKPDPAKLQGIKEMPPPTCKQDVKRLL 277

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVNY +RF  N +K+  PL
Sbjct: 278 GMVNYLQRFAPNLSKVTTPL 297



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/52 (28%), Positives = 23/52 (44%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +D    +  + +  E    T   TP+  Y +  M FG   A + FQR +D A
Sbjct: 128 VDAKNGFWHVQLDEESSYLTTFGTPWSRYRWTRMPFGFSPAPEEFQRRLDNA 179


>SB_49147| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)
          Length = 667

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 363 QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKRVEAIVEAPAPTNQSEVRSFL 422

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 423 GSAQFCAKFIPQFATISAPL 442



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL  A+ QI ++PE    T    P GLY +  + FG+  A + FQ  I
Sbjct: 279 LDLNMAFHQIELSPESRDITTFAAPTGLYRYCRLLFGVNMATEKFQNLI 327


>SB_31504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 767

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 46  QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKRVEAIVEAPAPTNQSEVRSFL 105

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 106 GSAQFCAKFIPQFATISAPL 125


>SB_28292| Best HMM Match : RVT_1 (HMM E-Value=2.3e-38)
          Length = 469

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 27/82 (32%), Positives = 49/82 (59%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + IE+ G+ +N  KC F   E+++ G+ I+  G  P  E+++A++    P+ V  LR+
Sbjct: 351 TLKIIEESGLKLNKEKCEFRKKEISYFGHVINQQGISPNPEKVRAIQALAAPENVSELRQ 410

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             GM+NY  +FL N + + AP+
Sbjct: 411 VTGMINYLDKFLPNLSTVMAPM 432



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/47 (36%), Positives = 26/47 (55%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  +    T  ITP G + F  +TFG+ +A + FQR
Sbjct: 269 LDASSGFWQIPLTDDSAKLTTFITPQGRFCFRRLTFGITSAPEMFQR 315


>SB_19411| Best HMM Match : RVT_1 (HMM E-Value=1.1e-32)
          Length = 541

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 29/80 (36%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q   + G+ +N  K      EV F+G+ IS+DG +P   ++Q +K+ P P   Q ++R +
Sbjct: 325 QRCREKGVKLNKEKLKLRCSEVDFMGHVISSDGLKPDPAKLQGIKEMPPPTCKQDVKRLL 384

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVNY + F  N +++ APL
Sbjct: 385 GMVNYLQSFAPNLSEVTAPL 404



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 16/52 (30%), Positives = 24/52 (46%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           ID    +  + +  E    T   TP+  Y +  M FG+  A + FQR +D A
Sbjct: 235 IDAKNGFWHVQLDEESSYLTTFGTPWSRYRWTRMPFGISPASEKFQRRLDNA 286


>SB_1797| Best HMM Match : rve (HMM E-Value=8.5e-35)
          Length = 285

 Score = 64.9 bits (151), Expect = 6e-11
 Identities = 27/61 (44%), Positives = 42/61 (68%)
 Frame = +1

Query: 304 PEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           P + +LG+ I  DG  P S++++A+K  P PQ V  LR F+G+VNYY++FL N +++  P
Sbjct: 1   PSLKYLGHVIDKDGIHPTSDKVEAIKTSPSPQDVTQLRAFLGLVNYYQKFLPNLSQVLQP 60

Query: 484 L 486
           L
Sbjct: 61  L 61


>SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35)
          Length = 1772

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 27/66 (40%), Positives = 44/66 (66%)
 Frame = +1

Query: 304 PEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           PEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM+NYY  ++ N   + +P
Sbjct: 2   PEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGMLNYYACYIPNITTILSP 61

Query: 484 LVNAIV 501
           L   +V
Sbjct: 62  LHQLLV 67



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 70  TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 116


>SB_16279| Best HMM Match : DNA_pol_viral_C (HMM E-Value=3.6)
          Length = 360

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 27/66 (40%), Positives = 44/66 (66%)
 Frame = +1

Query: 304 PEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           PEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F+GM+NYY  ++ N   + +P
Sbjct: 2   PEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAFLGMLNYYACYILNITTILSP 61

Query: 484 LVNAIV 501
           L   +V
Sbjct: 62  LHQLLV 67



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/47 (36%), Positives = 24/47 (51%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           TP  W+   E+ +N  K +L S+ L+ H     EL L  DAS   +G
Sbjct: 70  TPWNWSEAHEKSWNQAKSTLHSSQLLVHYSLERELTLACDASPYGLG 116


>SB_19544| Best HMM Match : Ribosomal_S18 (HMM E-Value=4.9)
          Length = 208

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 27/82 (32%), Positives = 49/82 (59%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + Q IE+ G+ +N  KC F   ++++ G+ I+  G  P  E+++A++    P+ V  LR+
Sbjct: 92  TLQIIEESGLKLNKEKCEFRKKKISYFGHVINQQGISPNPEKVRAIQALAAPENVSELRQ 151

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             GM+NY  +FL N + + AP+
Sbjct: 152 ATGMINYLGKFLPNLSTVMAPM 173



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/47 (38%), Positives = 25/47 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  ITP G + F  +TFG+ +A   FQR
Sbjct: 10  LDASSGFWQIPLTDESAKLTTFITPQGRFCFRRLTFGITSAPGIFQR 56


>SB_16657| Best HMM Match : RVT_1 (HMM E-Value=6.4e-18)
          Length = 1138

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 28/80 (35%), Positives = 47/80 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   +R++A+ + P P     +R F+
Sbjct: 578 QKMQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKRVEAIVEAPAPTNQSEVRSFL 637

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 638 GSAQFCAKFIPQFATISAPL 657



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 17/49 (34%), Positives = 25/49 (51%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL  A+ QI ++PE    T      GLY +  + FG+  A + FQ  I
Sbjct: 494 LDLNMAFHQIELSPESRDITTFAASTGLYRYCRLLFGVNMATEKFQNLI 542


>SB_6987| Best HMM Match : RVT_1 (HMM E-Value=2.2e-21)
          Length = 521

 Score = 64.5 bits (150), Expect = 8e-11
 Identities = 33/80 (41%), Positives = 49/80 (61%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 134 QRLKDAGVKLNE-KCEFSKQRMKFLGHVISEDGVEADPEK-KAIQDFPRPTTVTELQRFN 191

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMVN   +F+ + A +  PL
Sbjct: 192 GMVNQLAKFIPDVATINEPL 211



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/46 (39%), Positives = 26/46 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQ
Sbjct: 50  LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQ 95


>SB_36806| Best HMM Match : RVT_1 (HMM E-Value=3.1e-35)
          Length = 380

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 27/78 (34%), Positives = 46/78 (58%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I + G+++NP KC F   ++ +LG  I  +G +    +++A+ D  +P+ +  LRRF+GM
Sbjct: 272 ITEIGMILNPDKCKFSEKKIEYLGQVIDNEGIKKNPAKVKAIVDMDVPRDIPSLRRFLGM 331

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN   +F  N A+   PL
Sbjct: 332 VNQLMKFCPNLAEKTQPL 349



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/51 (31%), Positives = 29/51 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +D    + Q+P++ E    T  ITPF  Y F  + +G+ +A + FQ+ +D+
Sbjct: 186 LDTNSGFHQVPLSEESAKLTTFITPFRRYMFRRLPYGISSAPEYFQKKMDQ 236


>SB_15863| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 922

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 26/82 (31%), Positives = 49/82 (59%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + I++ G+ +N  KC F   E+++ G+ I+  G  P  E+++A++    P+ V  LR+
Sbjct: 293 TLKIIKESGLKLNKEKCEFRKKEISYFGHVINQQGISPNPEKVRAIQALAAPENVSELRQ 352

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             GM+NY  +FL N + + AP+
Sbjct: 353 VTGMINYLGKFLPNLSTVMAPM 374



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  ITP G + F  + FG+ +A + FQR
Sbjct: 211 LDASSGFWQIPLTDESAKLTTFITPQGRFCFRRLPFGITSAPEIFQR 257



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/43 (32%), Positives = 24/43 (55%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           WT   +E F+  K+ +S+  ++A   PN  + +  DASS  +G
Sbjct: 386 WTEVQQEAFDKVKEMVSTTPVLAFYDPNKAITVSADASSYGIG 428


>SB_47642| Best HMM Match : RVT_1 (HMM E-Value=6.7e-21)
          Length = 1336

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 24/76 (31%), Positives = 47/76 (61%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           + G+  NP K     PEV+++G+  +++G +P  E+++A+ + P P     ++RF+G +N
Sbjct: 573 EVGLKFNPKKIKLRVPEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDCVQRFLGTIN 632

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F+ + A LQ P+
Sbjct: 633 YLDKFIEHKADLQGPI 648



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+D    Y Q+ V  E        TP+G Y F  + FG+ +A + +QR +D
Sbjct: 485 TLDACSGYWQVEVDEESSKLLTFNTPWGRYRFTRLPFGISSAPEIYQREMD 535


>SB_36217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1356

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 29/50 (58%), Positives = 34/50 (68%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           TIDL  AY Q+ V P D  KTA  TP GL+E+N M FGL+NA  TFQR +
Sbjct: 517 TIDLASAYNQVEVDPRDRHKTAFTTPMGLFEYNRMPFGLQNAPATFQRLM 566



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/45 (37%), Positives = 28/45 (62%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQAL 378
           F+   ++G+ I P+KC F   +V +LG+ +SADG     E+ +AL
Sbjct: 603 FRKPREHGLKIEPSKCQFFRGQVPYLGHIVSADGVATDPEKTKAL 647



 Score = 35.1 bits (77), Expect = 0.053
 Identities = 16/48 (33%), Positives = 29/48 (60%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFNR 677
           WTPE +  F+  +  L++A ++A+P  N    + TDAS+  +GA  ++
Sbjct: 664 WTPECQAAFDQLRTLLTTAPVLAYPDYNQPFIVETDASNEGLGAVLSQ 711


>SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066)
          Length = 444

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 25/74 (33%), Positives = 45/74 (60%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  K      EV F+G+ +SADG +P  +++Q +++ P P   + ++R +GM NY 
Sbjct: 314 GIKLNKEKLKLRCAEVKFMGHVVSADGLKPDPDKLQGIEEMPTPTNKRDIKRLLGMANYL 373

Query: 445 RRFLRNAAKLQAPL 486
           ++F  N ++  AP+
Sbjct: 374 QKFASNLSEAAAPM 387



 Score = 31.9 bits (69), Expect = 0.49
 Identities = 14/42 (33%), Positives = 23/42 (54%)
 Frame = +3

Query: 36  PVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           PV     C++ +  P G Y +  M FG+  A + FQR +++A
Sbjct: 228 PVPSLHACRSTLEDPRGRYRWTRMPFGIAPAPEEFQRRLEQA 269


>SB_20138| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 860

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/52 (53%), Positives = 35/52 (67%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           TID+V  Y Q+ VAPED  KTA  TPFGLY++  M FGL  A  TFQ  +++
Sbjct: 214 TIDMVSGYHQVEVAPEDRAKTAFTTPFGLYQYCRMPFGLTGAPGTFQSVVED 265


>SB_38788| Best HMM Match : rve (HMM E-Value=4e-06)
          Length = 956

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 31/74 (41%), Positives = 46/74 (62%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  KC F   ++ +LG+ IS    +   E+ +A++DFP P TV+ L+RF GMVN  
Sbjct: 429 GITLND-KCEFSKQKIKYLGHIISEKEVETDPEKNKAIQDFPRPNTVKELQRFNGMVNQL 487

Query: 445 RRFLRNAAKLQAPL 486
            +FL + AK+  PL
Sbjct: 488 AKFLPDLAKINEPL 501



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 3/41 (7%)
 Frame = +3

Query: 33  IPVAP-EDICK--TAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +P  P +D CK     +TP+G + FN + FG+ +A + FQR
Sbjct: 345 LPKIPLDDECKLLATFVTPYGRFCFNRLPFGISSAPEVFQR 385


>SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36)
          Length = 1198

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 27/78 (34%), Positives = 45/78 (57%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I + G+ +NP KC F   ++ +LG  I  +G +    +++A+ D  +P+ +  LRRF+GM
Sbjct: 442 ITEIGMTLNPDKCKFSEKKIEYLGQVIDNEGIKKNPAKVKAIVDMDVPRDIPSLRRFLGM 501

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN   +F  N A+   PL
Sbjct: 502 VNQLMKFCPNLAERTQPL 519



 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 17/52 (32%), Positives = 30/52 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +D    + Q+P++ E    T  ITPFG Y    + +G+ +A + FQ+ +D+A
Sbjct: 356 LDANSVFHQVPLSEESAKLTTFITPFGRYMLRRLPYGISSAPEYFQKKMDQA 407



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +3

Query: 528 ITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           + W    ++ FN  K+ ++S  ++A   P  E  +  DASS  +GA
Sbjct: 529 LVWGKAQDDAFNDLKEEIASERVLALYSPEKETVVSADASSFGLGA 574


>SB_31834| Best HMM Match : RVT_1 (HMM E-Value=0.019)
          Length = 514

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 25/74 (33%), Positives = 44/74 (59%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  K      EV F+G+ +S DG +P  +++Q +++ P P   Q ++R +GM NY 
Sbjct: 234 GIKLNKEKLKLRCAEVKFMGHVVSTDGLKPDPDKLQGIEEMPTPTNKQDIKRLLGMANYL 293

Query: 445 RRFLRNAAKLQAPL 486
           ++F  N ++  AP+
Sbjct: 294 QKFAPNLSEAAAPM 307


>SB_28907| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 726

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 25/74 (33%), Positives = 44/74 (59%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  K      EV F+G+ +S DG +P  +++Q +++ P P   Q ++R +GM NY 
Sbjct: 608 GIKLNKEKLKLPCAEVKFMGHVVSTDGLKPDPDKLQGIEEMPTPTNKQDIKRLLGMANYL 667

Query: 445 RRFLRNAAKLQAPL 486
           ++F  N ++  AP+
Sbjct: 668 QKFAPNLSEAAAPM 681



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +D    +  I +  E    T   TP+G Y +  M FG+  A + FQR +++A
Sbjct: 512 VDAKNGFWHIQLDDESSFLTTFGTPWGRYRWTRMPFGIAPAPEEFQRRLEQA 563


>SB_12598| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 799

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 24/61 (39%), Positives = 41/61 (67%)
 Frame = +1

Query: 304 PEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           PEV+++G+  +ADG +P  E+++A+ + P P    G+ RF+G VNY  +F+ + A LQ P
Sbjct: 284 PEVSYVGHLFTADGLKPDPEKVRAINEMPAPTDKDGILRFLGTVNYLDKFIEHKADLQGP 343

Query: 484 L 486
           +
Sbjct: 344 I 344


>SB_11292| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1529

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 28/78 (35%), Positives = 46/78 (58%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +++ G+ +N  KCVF   E+TF+G  +S+ G  P   R++A+     PQT   +R F+G+
Sbjct: 1018 LKNKGLTLNKEKCVFRMSELTFMGYLLSSKGIGPTESRVEAVLSAKEPQTAGEVRSFLGL 1077

Query: 433  VNYYRRFLRNAAKLQAPL 486
            VN+  RF+ + A    PL
Sbjct: 1078 VNFSARFIPDLATTAEPL 1095



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 12/51 (23%), Positives = 25/51 (49%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +DL   + QI +  +    T   T  GL+ +  + FG+ +A + +Q  + +
Sbjct: 932  LDLKWGFHQIELDEQSRVITTFATHEGLFRYKRLMFGISSATELYQHIVQQ 982


>SB_5085| Best HMM Match : Op_neuropeptide (HMM E-Value=1.6)
          Length = 268

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 25/74 (33%), Positives = 44/74 (59%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  K      EV F+G+ +S DG +P  +++Q +++ P P   Q ++R +GM NY 
Sbjct: 64  GIKLNKEKLELRCAEVKFMGHVVSTDGLKPDPDKLQGIEEMPTPTNKQDIKRLLGMANYL 123

Query: 445 RRFLRNAAKLQAPL 486
           ++F  N ++  AP+
Sbjct: 124 QKFAPNLSEAAAPM 137



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 534 WTPELE-ECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGAC 668
           W  +++ + F   K  +S A ++    P+ E+GL  DAS   +GAC
Sbjct: 149 WDEQVQGQSFKNVKKIVSQAPVLKFFDPHEEVGLQCDASEKGMGAC 194


>SB_56354| Best HMM Match : RVT_1 (HMM E-Value=3.4e-19)
          Length = 340

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 27/80 (33%), Positives = 46/80 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KCV GA  + F+G+ ISADG +   + ++A+ + P P     +R F+
Sbjct: 163 QKLQDSGLTLNYEKCVVGASSMDFMGDTISADGLKLSDKSVEAIVEAPAPTNQSEVRTFL 222

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G   +  +F+   A + APL
Sbjct: 223 GSAQFCAKFIPQFATISAPL 242



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/49 (36%), Positives = 26/49 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
           +DL  A+ QI ++PE    T    P GLY +  + FG+  A + FQ  I
Sbjct: 79  LDLNMAFHQIELSPESRDITTFAAPTGLYRYCRLLFGVNMATEKFQNLI 127


>SB_4743| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 146

 Score = 62.5 bits (145), Expect = 3e-10
 Identities = 28/77 (36%), Positives = 49/77 (63%), Gaps = 1/77 (1%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKD-FPLPQTVQGLRRFIGMV 435
           + G+  NP+K      EV+ +G+R+++ G QP   +I+A+ D +P P   +G++R IG V
Sbjct: 8   EVGLKFNPSKVKLRVDEVSDVGHRLTSQGLQPDPGKIKAIIDIYPPPTDKEGVQRLIGTV 67

Query: 436 NYYRRFLRNAAKLQAPL 486
           NY  +F +N A++Q P+
Sbjct: 68  NYLDKFFQNKAEIQGPI 84


>SB_35198| Best HMM Match : rve (HMM E-Value=8.1e-20)
          Length = 745

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 26/82 (31%), Positives = 48/82 (58%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + IE+ G+ +N  KC F   E+++ G+ I+  G  P  E+++A++    P+ V  L +
Sbjct: 92  TLKIIEESGLKLNKEKCEFRKKEISYFGHVINQQGISPNPEKVRAIQALAAPENVSELSQ 151

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             GM+NY  +FL N + + AP+
Sbjct: 152 ATGMINYLGKFLPNLSTVMAPM 173



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  ITP G + F  + FG+ +A + FQR
Sbjct: 10  LDASSGFWQIPLTDESAKLTTFITPQGRFCFRRLPFGITSAPEIFQR 56


>SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0)
          Length = 2376

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 29/86 (33%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRR 420
            Q + + G+ +   KC     EV++LG  +SADG +     I+A+ D     PQTV+ +RR
Sbjct: 1394 QQLREKGVKLKRKKCHVFQKEVSYLGRLVSADGYRVDPSGIKAVTDLKTAKPQTVKEVRR 1453

Query: 421  FIGMVNYYRRFLRNAAKLQAPLVNAI 498
             +G++ YYRR++++ A++  PL + +
Sbjct: 1454 IVGLLGYYRRYIQDFARIAKPLYDLL 1479



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 20/52 (38%), Positives = 30/52 (57%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
            +D  KAY Q  +       TA +T +GL+E+  + FGLR A   +QRF++ A
Sbjct: 1308 LDQGKAYHQSRLKESSQHLTAFVTSWGLFEWKRIPFGLRTAPSCYQRFMEGA 1359



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 13/46 (28%), Positives = 28/46 (60%)
 Frame = +2

Query: 164  DFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNACLV 301
            D C  Y+D ++VYS+   +H  +LR + ++L+  + + +++  C V
Sbjct: 1366 DICVPYLDGVIVYSKTFEKHVTNLRRVLQQLR-EKGVKLKRKKCHV 1410


>SB_284| Best HMM Match : rve (HMM E-Value=0.001)
          Length = 1201

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 25/74 (33%), Positives = 44/74 (59%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  K      EV F+G+ +S DG +P  +++Q +++ P P   Q ++R +GM NY 
Sbjct: 554 GIKLNREKLKLRCAEVKFMGHVVSTDGLKPDPDKLQGIEEMPTPTNKQDIKRLLGMANYL 613

Query: 445 RRFLRNAAKLQAPL 486
           ++F  N ++  AP+
Sbjct: 614 QKFAPNLSEAAAPM 627


>SB_28182| Best HMM Match : RnaseH (HMM E-Value=1.8)
          Length = 507

 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 26/82 (31%), Positives = 48/82 (58%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + IE+ G+ +N  KC F   E+++ G+ I+  G  P  E+++A++    P+ V  L +
Sbjct: 92  TLKIIEESGLKLNKEKCEFRKKEISYFGHVINQQGISPNPEKVRAIQALAAPENVSELSQ 151

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             GM+NY  +FL N + + AP+
Sbjct: 152 ATGMINYLGKFLPNLSTVMAPM 173



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 17/47 (36%), Positives = 25/47 (53%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  ITP G + F  + FG+ +A + FQR
Sbjct: 10  LDASSGFWQIPLTDESAKLTTFITPQGRFCFRRLPFGITSAPEIFQR 56


>SB_13297| Best HMM Match : RnaseH (HMM E-Value=0.37)
          Length = 393

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 25/82 (30%), Positives = 50/82 (60%), Gaps = 2/82 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRR 420
           Q + ++G+ + P+KC F   E+T+LG+ ++ +G +P  ++++ALK++    P   + L+ 
Sbjct: 54  QRLSEFGLKLKPSKCKFFQTELTYLGHVVTREGVKPDPKKVEALKEWRQHPPTNAKDLQT 113

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
           F+G   YYR F+   + +  PL
Sbjct: 114 FLGFAGYYRTFVERFSVIAEPL 135


>SB_12220| Best HMM Match : RVT_1 (HMM E-Value=7.3e-19)
          Length = 2253

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 28/73 (38%), Positives = 46/73 (63%)
 Frame = +1

Query: 268  IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
            I  N  K      +V +LGN ++ADG +P  E+ +A+K+ P P+T Q L+R +GMVNY  
Sbjct: 967  IRFNRDKIQLRVNQVKYLGNIVTADGFKPDPEKTKAIKEMPQPETKQDLQRLLGMVNYLS 1026

Query: 448  RFLRNAAKLQAPL 486
            +++   +++ APL
Sbjct: 1027 QYIPIMSEITAPL 1039



 Score = 31.9 bits (69), Expect = 0.49
 Identities = 16/51 (31%), Positives = 24/51 (47%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            ID+   Y    +  E        TPFG ++F+ M FG+  A    Q+ ID+
Sbjct: 876  IDMSNCYWHKKLDEESSYLCTFNTPFGRHKFDRMPFGISVAADVAQKMIDD 926


>SB_39048| Best HMM Match : RVT_1 (HMM E-Value=1.9e-23)
          Length = 1062

 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 26/82 (31%), Positives = 48/82 (58%)
 Frame = +1

Query: 241 SFQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRR 420
           + + I++ G+ +N  KC F   E+++ G+ I+  G  P  E+++A+K    P+ V  LR+
Sbjct: 723 TLKIIKESGLKLNKEKCEFRKKEISYFGHVINQQGISPNPEKVRAIKALAAPENVSELRQ 782

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
             GM+N   +FL N + + AP+
Sbjct: 783 VTGMINCLGKFLPNLSTVMAPM 804



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 16/41 (39%), Positives = 22/41 (53%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           + QIP+  E    T  ITP G + F  + FG+  A + FQR
Sbjct: 647 FWQIPLTDESAKLTTFITPQGRFCFRRLPFGITVASEIFQR 687


>SB_31551| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)
          Length = 429

 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 25/78 (32%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +   KCVF   +V +LG++I   G  P  ++++AL     P+ V  LR ++G+
Sbjct: 166 LDEAGLRLKREKCVFMQDKVVYLGHQIDKTGISPVKDKVEALVKAKTPENVTELRAYLGL 225

Query: 433 VNYYRRFLRNAAKLQAPL 486
           +NYY +FL+  +++  PL
Sbjct: 226 LNYYGKFLKGLSQVLHPL 243



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY Q+ + P+    T I T  G++++  + +G+ +A   FQR I+E
Sbjct: 80  LDLSHAYSQVELDPDSRKFTTINTVKGMFQYKRLPYGVASAPAAFQRAIEE 130



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W PE + CF   K  + SA L+ H      L L  DAS   +GA
Sbjct: 255 WGPEQQTCFELTKKMILSAGLLVHYDTERALVLHCDASQYGLGA 298


>SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30)
          Length = 1191

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 28/81 (34%), Positives = 47/81 (58%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F  I + G+ +NP KC F + ++ +LG  I  +G +    +++A+ D  +P+ +  LRRF
Sbjct: 606 FHRITEIGMTLNPDKCKF-SEKIEYLGQVIDNEGIKKNPAKVKAIVDMDVPRDIPSLRRF 664

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +GMVN   +F  N A+   PL
Sbjct: 665 LGMVNQLMKFCPNLAEKTQPL 685



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 16/51 (31%), Positives = 28/51 (54%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +D    + Q+P + E    T  I PFG Y F  + +G+ +A + FQ+ +D+
Sbjct: 523 LDANSGFHQVPSSEESAKLTTFINPFGRYMFRRLPYGISSAPEYFQKKMDQ 573


>SB_16776| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1306

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 29/68 (42%), Positives = 43/68 (63%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +N  KC F  P V FLG+ I   G +P   + +A+K FP PQTV  L+RF  M
Sbjct: 463 LQEAGVTLNE-KCEFSKPSVKFLGHIIDQRGVRPDPAKTEAIKSFPTPQTVNDLQRF--M 519

Query: 433 VNYYRRFL 456
           V+YY R++
Sbjct: 520 VDYYSRWV 527



 Score = 35.1 bits (77), Expect = 0.053
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQ 143
           +D    + Q+P+  E    T  ITP+G + FN + FG+ +A + +Q
Sbjct: 377 LDANSGFWQLPLDKESPLLTTFITPYGRFCFNRVPFGICSAPEVYQ 422


>SB_21616| Best HMM Match : RVT_1 (HMM E-Value=0.00011)
          Length = 1380

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 26/78 (33%), Positives = 45/78 (57%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I + G+ +NP KC F   ++ +LG  I  +G +   ++++A+    +P+ +  LRRF+GM
Sbjct: 597 ITEIGMTLNPDKCKFSEKKIEYLGQVIDNEGMKKDPDKVKAIVGMGVPRDIPSLRRFLGM 656

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN   +F  N A+   PL
Sbjct: 657 VNQLMKFCPNLAERTQPL 674



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 16/45 (35%), Positives = 28/45 (62%)
 Frame = +3

Query: 24  YQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           + Q+P++ E    T  ITPFG Y F  + +G+ +A + FQ+ +D+
Sbjct: 517 FHQVPLSEESAKLTTFITPFGRYMFRRLPYGISSAPEYFQKKMDQ 561


>SB_51280| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 169

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 28/77 (36%), Positives = 43/77 (55%)
 Frame = +1

Query: 256 EDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMV 435
           ++ GIV N  K  F   EV+F G+  S +G  P  +++ A+ D   P+  + L+ F+G+V
Sbjct: 87  QEKGIVFNAEKLQFKCNEVSFFGHTWSPEGVPPDKKKVSAILDMEAPKDTKNLQSFLGLV 146

Query: 436 NYYRRFLRNAAKLQAPL 486
           NY  R+    A L APL
Sbjct: 147 NYLTRYSGQLATLTAPL 163



 Score = 37.1 bits (82), Expect = 0.013
 Identities = 18/48 (37%), Positives = 26/48 (54%)
 Frame = +3

Query: 18  KAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           K Y  +P+  E    T   TPFG ++F+ + FGL  +   FQR +D A
Sbjct: 4   KGYWHVPLDNESSYLTTFGTPFGRFKFSRLPFGLVVSQDIFQRQLDSA 51


>SB_15534| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1041

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 28/77 (36%), Positives = 43/77 (55%)
 Frame = +1

Query: 256 EDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMV 435
           ++ GIV N  K  F   EV+F G+  S +G  P  +++ A+ D   P+  + L+ F+G+V
Sbjct: 461 QEKGIVFNAEKLQFKCNEVSFFGHTWSPEGVPPDKKKVSAILDMEAPKDTKNLQSFLGLV 520

Query: 436 NYYRRFLRNAAKLQAPL 486
           NY  R+    A L APL
Sbjct: 521 NYLTRYSGQLATLTAPL 537


>SB_55897| Best HMM Match : RVT_1 (HMM E-Value=5.3e-37)
          Length = 732

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 24/78 (30%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +   KCVF   +V +LG++I   G  P  ++++AL     P+ V  L+ ++G+
Sbjct: 193 LDEAGLRLKREKCVFMQDKVVYLGHQIDKTGISPVKDKVEALVKAKTPENVTELKAYLGL 252

Query: 433 VNYYRRFLRNAAKLQAPL 486
           +NYY +FL+  +++  PL
Sbjct: 253 MNYYGKFLKGLSQVLHPL 270



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY Q+ + P+    T I T  G++++  + +G+ +A   FQR I+E
Sbjct: 107 LDLSHAYSQVELDPDSRKFTTINTVKGMFQYKRLPYGVASAPAAFQRAIEE 157



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W PE + CF   K  + SA L+ H      L L  DAS   +GA
Sbjct: 282 WGPEQQTCFELTKKMILSAGLLVHYDTERALVLHCDASQYGLGA 325


>SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1829

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 24/78 (30%), Positives = 48/78 (61%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +++ G+ +   KCVF   +V +LG++I   G  P  ++++AL     P+ V  L+ ++G+
Sbjct: 1136 LDEAGLRLKREKCVFMQDKVVYLGHQIDKTGISPVKDKVEALVKAKTPENVTELKAYLGL 1195

Query: 433  VNYYRRFLRNAAKLQAPL 486
            +NYY +FL+  +++  PL
Sbjct: 1196 LNYYGKFLKGLSQVLHPL 1213



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +DL  AY Q+ + P+    T I T  G++++  + +G+ +A   FQR I+E
Sbjct: 1050 LDLSHAYSQVELDPDSRKFTTINTVKGMFQYKRLPYGVASAPAAFQRAIEE 1100



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            W PE + CF   K  + SA L+ H      L L  DAS   +GA
Sbjct: 1225 WGPEQQTCFELTKKMILSAGLLVHYDTERALVLHCDASQYGLGA 1268


>SB_28930| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 727

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 27/78 (34%), Positives = 45/78 (57%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +N  KCVF   E+ F+G  +S+ G  P   R++A+     PQT   +R F+G+
Sbjct: 261 LKNKGLTLNKKKCVFRMSELIFMGYLLSSKGIGPTESRVEAVLSAKEPQTAGEVRSFLGL 320

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN+  RF+ + A    PL
Sbjct: 321 VNFSARFIPDLATTAEPL 338


>SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30)
          Length = 1280

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 24/78 (30%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +   KCVF   +V +LG++I   G  P  ++++AL     P+ V  L+ ++G+
Sbjct: 427 LDEAGLRLKREKCVFMQDKVVYLGHQIDKTGISPVKDKVEALVKAKTPENVTELKAYLGL 486

Query: 433 VNYYRRFLRNAAKLQAPL 486
           +NYY +FL+  +++  PL
Sbjct: 487 LNYYGKFLKGLSQVLHPL 504



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL  AY Q+ + P+    T I T  G++++  + +G+ +A   FQR I+E
Sbjct: 341 LDLSHAYSQVELDPDSRKFTTINTVKGMFQYKRLPYGVASAPAAFQRAIEE 391



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W PE + CF   K  + SA L+ H      L L  DAS   +GA
Sbjct: 516 WGPEQQTCFELTKKMILSAGLLVHYDTERALVLHCDASQYGLGA 559


>SB_39271| Best HMM Match : Secretin_N (HMM E-Value=2.4)
          Length = 300

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 24/78 (30%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +   KCVF   +V +LG++I   G  P  ++++AL     P+ V  L+ ++G+
Sbjct: 78  LDEAGLRLKREKCVFMQDKVVYLGHQIDKTGISPVKDKVEALVKAKTPENVTELKAYLGL 137

Query: 433 VNYYRRFLRNAAKLQAPL 486
           +NYY +FL+  +++  PL
Sbjct: 138 LNYYGKFLKGLSQVLHPL 155



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W PE + CF   K  + SA L+ H      L L  DAS   +GA
Sbjct: 167 WGPEQQTCFELTKKMILSAGLLVHYDTERALVLHCDASQYGLGA 210


>SB_28811| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 982

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 27/51 (52%), Positives = 35/51 (68%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           ++DL   Y Q+ V  ED  KTA+ TPFGL+EFN M FGL N+  TFQR ++
Sbjct: 394 SLDLQSGYLQVEVEEEDKSKTAMTTPFGLFEFNRMPFGLTNSPATFQRLME 444



 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 24/83 (28%), Positives = 50/83 (60%), Gaps = 3/83 (3%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDF---PLPQTVQGLR 417
           Q + ++G+ + P+KC     E+T+LG+ ++ +G +P  ++++AL+++   PL    + L+
Sbjct: 481 QRLSEFGLKLKPSKCKLFQTELTYLGHVVTREGVKPDPKKVEALEEWRQHPL-TNAKDLQ 539

Query: 418 RFIGMVNYYRRFLRNAAKLQAPL 486
            F+G   YYR F+   + +  PL
Sbjct: 540 TFLGFAGYYRTFVERFSVIAEPL 562



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           WT E +  F    D L S+A++A P  N    L  DAS   +GA
Sbjct: 578 WTAECQGAFECVIDRLCSSAVLAFPDFNKPFVLHKDASGEGLGA 621


>SB_9508| Best HMM Match : Secretin_N (HMM E-Value=1.8)
          Length = 391

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 24/78 (30%), Positives = 48/78 (61%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +   KCVF   +V +LG++I   G  P  ++++AL     P+ V  L+ ++G+
Sbjct: 60  LDEAGLRLKREKCVFMQDKVVYLGHQIDKTGISPVKDKVEALVKAKTPENVTELKAYLGL 119

Query: 433 VNYYRRFLRNAAKLQAPL 486
           +NYY +FL+  +++  PL
Sbjct: 120 LNYYGKFLKGLSQVLHPL 137



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 17/44 (38%), Positives = 21/44 (47%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W PE + CF   K  + SA L+ H      L L  DAS   +GA
Sbjct: 149 WGPEQQTCFELTKKMILSAGLLVHYDTEKALVLHCDASQYGLGA 192


>SB_3147| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 539

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GIV N  K  F   EV+F G+  S +G +P ++++ A+ D   P+  + L+ F+G+VNY 
Sbjct: 199 GIVFNAEKLQFKCNEVSFFGHTWSPEGVRPDNKKVSAILDMEEPKDTKNLQSFLGLVNYL 258

Query: 445 RRFLRNAAKLQAPL 486
            R+    A L APL
Sbjct: 259 TRYSGQLATLTAPL 272



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W PE +E F   K+ +SS  ++ +  P  E  + TDAS   VGA
Sbjct: 284 WGPEHDEAFKKVKEEISSLGVLRYFDPKEETVIQTDASLKGVGA 327


>SB_47416| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1413

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 28/63 (44%), Positives = 39/63 (61%)
 Frame = +1

Query: 310 VTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPLV 489
           V FLG+ I A+G  P  E+++A+ D P P  V  LR F+GM+ YY +FL N + L  PL 
Sbjct: 581 VGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFLGMLQYYGKFLPNLSTLLHPLN 640

Query: 490 NAI 498
           N +
Sbjct: 641 NLL 643



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 494 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 543



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           +W PE E+ F + K+ L  A ++ H   N  + L  DAS   +GA
Sbjct: 650 SWLPECEQAFTSAKELLQLAKVLTHYDVNLPIKLACDASPYGIGA 694


>SB_1422| Best HMM Match : Synaphin (HMM E-Value=7.3)
          Length = 263

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/78 (33%), Positives = 44/78 (56%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I +  + +NP KC F   ++ +LG  I  +G +    +++A+ D  +P+ +  LRRF+GM
Sbjct: 106 ITEIDMTLNPDKCKFSEKKIEYLGQVIDNEGIKKNPAKVKAIVDMDVPRDIPSLRRFLGM 165

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN   +F  N A+   PL
Sbjct: 166 VNQLMKFCPNLAEKTQPL 183



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +D    + Q+P++ E    T  ITPFG Y F  + +G+ +A + FQ+ +D+
Sbjct: 20  LDANSGFHQVPLSEESAKLTTFITPFGRYMFRRLPYGISSAPEYFQKKMDQ 70


>SB_52461| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 398

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++ + +NP K  F    VT+LG+ +SADG     E+++A+ + P P  + G++R IG+V 
Sbjct: 120 EHNLKLNPKKLKFKLDRVTYLGHVLSADGITADPEKVKAICEMPQPVDIAGVQRLIGVVT 179

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +FL   + +  PL
Sbjct: 180 YLSKFLPQLSAVAEPL 195


>SB_52459| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 555

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 26/76 (34%), Positives = 45/76 (59%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++ + +NP K  F    VT+LG+ +SADG     E+++A+ + P P  + G++R IG+V 
Sbjct: 277 EHNLKLNPKKLKFKLDRVTYLGHVLSADGITADPEKVKAICEMPQPVDIAGVQRLIGVVT 336

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +FL   + +  PL
Sbjct: 337 YLSKFLPQLSAVAEPL 352


>SB_46540| Best HMM Match : RVT_1 (HMM E-Value=4.8e-27)
          Length = 751

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/51 (52%), Positives = 34/51 (66%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           ++DL   Y Q+ V  ED  KTA+ TPFGL+EFN M FGL N   TFQR ++
Sbjct: 206 SLDLQSGYLQVEVEEEDKSKTAMTTPFGLFEFNRMPFGLTNTPATFQRLME 256



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           + C AY+DD++V++R   +    L  + +RL+
Sbjct: 265 NICLAYLDDVIVFARTFEEMLHRLEAVLQRLR 296


>SB_14926| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1638

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 27/74 (36%), Positives = 43/74 (58%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           G+ +N  K      EV F+G+ I +DG +P   ++Q +K+ P     Q ++R +GMVNY 
Sbjct: 640 GVKLNKEKLKLRCSEVDFMGHVIPSDGLKPDPAKLQGIKEMPPSTCKQDVKRLLGMVNYL 699

Query: 445 RRFLRNAAKLQAPL 486
           +RF  N  ++ APL
Sbjct: 700 QRFAPNLFEVTAPL 713


>SB_12433| Best HMM Match : RVT_1 (HMM E-Value=0.00019)
          Length = 1234

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 21/61 (34%), Positives = 42/61 (68%)
 Frame = +1

Query: 304 PEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAP 483
           PEV+++G+  +++G +P  E+++A+ + P P    G++RF+G +NY  +F+ + A LQ P
Sbjct: 259 PEVSYVGHVFTSEGLKPDPEKVRAISEMPPPSDKDGVQRFLGTINYLDKFIEHKADLQGP 318

Query: 484 L 486
           +
Sbjct: 319 I 319



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +3

Query: 3    TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            T+DL +AY Q+ +  +      I T  GLY+   + +G+ +A   +QR +D+
Sbjct: 934  TLDLRQAYLQMELEDDAKKYLTINTTCGLYQCQRLAYGIASAPAIWQRAMDQ 985


>SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41)
          Length = 1069

 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           TID+   Y Q+ VAPED  KTA  TPFGLY++  M FGL  A  TFQ  ++
Sbjct: 626 TIDMGSGYHQVKVAPEDRAKTAFTTPFGLYQYCRMPFGLAGAPGTFQSVVE 676



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 24/80 (30%), Positives = 45/80 (56%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           QA+   G  ++  KC F    V FLG+ I  +G +P  E++  ++ +  P   + LR+FI
Sbjct: 713 QAVRASGFKLSGKKCQFATRSVKFLGHVIDQNGVRPQPEKLDIIRQWETPTNEEELRKFI 772

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G+  ++  F++  +++ APL
Sbjct: 773 GVCTFWTSFVKGFSEVAAPL 792



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 11/43 (25%), Positives = 23/43 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVG 662
           W+PE ++ F + K  L ++  ++ P  +    +  DAS+  +G
Sbjct: 803 WSPECDQTFESLKQLLCTSVTLSLPSQHGRFAVTCDASNRAIG 845


>SB_17119| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 618

 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I + G+ +NP KC F   ++ +LG  I  +G +    +++A+ D  +P+ +  LRRF+GM
Sbjct: 472 ITEIGMTLNPDKCKFSEKKIEYLGQVIDNEGIKKNPAKVKAIVDMDVPRDIPSLRRFLGM 531

Query: 433 VNYYRRFLRNAAK 471
           VN    F  N A+
Sbjct: 532 VNQLMNFCPNLAE 544



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +3

Query: 36  PVAPEDICK-TAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           P   E+  K T  ITPFG Y F  + +G+ +  + FQ+ +D+
Sbjct: 395 PTDCEESAKLTTFITPFGRYMFRRLPYGISSGPEYFQKKMDQ 436



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W    ++ FN  K+ ++S  ++A   P  E  +  DASS  +GA
Sbjct: 555 WGKAQDDAFNDLKEEMASERVLALYSPEKETVVSADASSFGLGA 598


>SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31)
          Length = 1283

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 28/80 (35%), Positives = 48/80 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++ G+ +  +K  F   ++ +LG  ISA G  P  E+++A+KD   P+ V  L+ FI
Sbjct: 554 QRLQECGLKLKESKFHFMLDQIVYLGFCISAAGISPAPEKVRAIKDAEPPRNVAELQSFI 613

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  N+ R+F+   A+L +PL
Sbjct: 614 GSANFLRKFVPAFAELASPL 633



 Score = 36.3 bits (80), Expect = 0.023
 Identities = 20/48 (41%), Positives = 25/48 (52%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TP  W    +E F   K ++ S  ++ H  P AEL L  DASS  VGA
Sbjct: 641 TPWKWEKVEQEAFECLKSAMCSDTVLQHYDPAAELVLHCDASSVGVGA 688


>SB_47002| Best HMM Match : RVT_1 (HMM E-Value=1.5e-16)
          Length = 894

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 31/109 (28%), Positives = 58/109 (53%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +E  G+ +N  KC F    VTFLG+ + +DG +    +I+A+ D   P+ +  LRRF+GM
Sbjct: 260 LESAGVTLNRDKCEFSKNRVTFLGHVVDSDGVRTDPTKIKAIADMKEPKDIHELRRFLGM 319

Query: 433 VNYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGHLSSKNALMPVKIA 579
            N   +F  +A ++      A +A + ++  +    L+  NA +  +++
Sbjct: 320 TNQLGKF-SSAPRMGPSQQQAFIAVK-EILCKDATVLAHYNAQLETRVS 366


>SB_25619| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1038

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 27/78 (34%), Positives = 44/78 (56%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           + + G+ +NP KC FG   VTFLG+ I   G      +++++ +   P  V  LR F+G+
Sbjct: 571 LSESGLTLNPEKCQFGLSSVTFLGHVILDKGIAADPGKVESIVNTRAPVNVTELRGFLGL 630

Query: 433 VNYYRRFLRNAAKLQAPL 486
           V Y  R++ + A L +PL
Sbjct: 631 VQYIGRYIPDLATLSSPL 648


>SB_47933| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 259

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 28/80 (35%), Positives = 48/80 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++ G+ +  +K  F   ++ +LG  ISA G  P  E+++A+KD   P+ V  L+ FI
Sbjct: 87  QRLQECGLKLKESKFHFMLDQIVYLGFCISAAGISPTPEKVRAIKDAEPPRNVAELQSFI 146

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  N+ R+F+   A+L +PL
Sbjct: 147 GSANFLRKFVPAFAELASPL 166



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TP  W    +E F   K ++ S  ++ H  P AEL L  D SS  VGA
Sbjct: 174 TPWKWEKVEQEAFECLKSAMCSDTVLQHYDPVAELVLHCDVSSVGVGA 221



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +3

Query: 63  TAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T   T  GLY++  +T+G+ +A   FQR I+
Sbjct: 22  TTANTTKGLYQYKRLTYGINSAVSIFQRTIE 52


>SB_42293| Best HMM Match : RVT_1 (HMM E-Value=0.0012)
          Length = 326

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 28/80 (35%), Positives = 48/80 (60%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q +++ G+ +  +K  F   ++ +LG  ISA G  P  E+++A+KD   P+ V  L+ FI
Sbjct: 154 QRLQECGLKLKESKFHFMLDQIVYLGFCISAAGISPTPEKVRAIKDAEPPRNVAELQSFI 213

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           G  N+ R+F+   A+L +PL
Sbjct: 214 GSANFLRKFVPAFAELASPL 233



 Score = 34.3 bits (75), Expect = 0.092
 Identities = 19/48 (39%), Positives = 24/48 (50%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TP  W    +E F   K ++ S  ++ H  P AEL L  D SS  VGA
Sbjct: 241 TPWKWEKVEQEAFECLKSAMCSDTVLQHYDPVAELVLHCDVSSVGVGA 288



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +3

Query: 63  TAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T   T  GLY++  +T+G+ +A   FQR I+
Sbjct: 89  TTANTTKGLYQYKRLTYGINSAVSIFQRTIE 119


>SB_21496| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1787

 Score = 58.4 bits (135), Expect = 5e-09
 Identities = 25/80 (31%), Positives = 44/80 (55%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q  +D+G   N  KC F   E+ F G+  + +G +P  ++++A+K+   P+  + +R F+
Sbjct: 725 QRAKDHGTTFNGEKCEFEKQEIEFFGHVFTNNGLRPAPDKVRAVKESERPEDKEAVRSFL 784

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GM  Y   F+   A + APL
Sbjct: 785 GMAGYLDNFISAYATIAAPL 804



 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 22/70 (31%), Positives = 40/70 (57%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q  +D+GI  N  KC F   E+ F G+  + +G +P  ++++A+K+   P+  + +R F+
Sbjct: 524 QRAKDHGITFNGEKCEFEKQEIEFFGHVFTNNGLRPAPDKVRAVKESERPEDKEAVRSFL 583

Query: 427 GMVNYYRRFL 456
           GM  Y   F+
Sbjct: 584 GMAGYLDNFI 593



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           C    DDIL+  RD  +HA  LRT+ +R K
Sbjct: 498 CINQRDDILIGGRDEAEHAETLRTVLQRAK 527



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           C    DDIL+  RD  +HA  LRT+ +R K
Sbjct: 699 CINQRDDILIGGRDEAEHAETLRTVLQRAK 728


>SB_56338| Best HMM Match : DUF970 (HMM E-Value=1.9)
          Length = 554

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 26/77 (33%), Positives = 44/77 (57%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +E+ G+ +  +KC F A +V +L +   A G     +++QAL +   P  V  L+ ++G+
Sbjct: 115 LEESGLRLKNSKCTFMADKVVYLEHCFGAQGIHQVEDKVQALLETRAPVNVSELKSYLGL 174

Query: 433 VNYYRRFLRNAAKLQAP 483
           +NYY RFL N +   AP
Sbjct: 175 LNYYNRFLPNLSTFIAP 191



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/47 (34%), Positives = 25/47 (53%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGACFN 674
           W    ++CF+  K  +++A ++ H  P   L L  DAS   VGA F+
Sbjct: 204 WGDPEQQCFDTTKKMITTAGVLVHYNPEQPLLLQCDASPYGVGAVFS 250


>SB_49427| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1958

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 23/82 (28%), Positives = 49/82 (59%), Gaps = 2/82 (2%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRR 420
           Q + ++G+ + P+KC F   E+ +LG+ ++ +G +P  ++++AL+++    P   + L+ 
Sbjct: 568 QRLSEFGLKLKPSKCKFFQTELAYLGHVVTREGVKPDPKKVEALEEWRQHPPTNAKDLQT 627

Query: 421 FIGMVNYYRRFLRNAAKLQAPL 486
           F+G   YYR F+   + +  PL
Sbjct: 628 FLGFAGYYRTFVERFSVIAEPL 649



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 20/37 (54%), Positives = 25/37 (67%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTF 113
           ++DL   Y Q+ V  ED  KTA+ TPFGL+EFN M F
Sbjct: 486 SLDLQSGYLQVEVEEEDKSKTAMTTPFGLFEFNRMPF 522



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           WT E +  F    D L S+A++A P  N    L  DAS   +GA
Sbjct: 656 WTAECQGAFECLIDRLCSSAVLAFPDFNKPFVLHKDASGEGLGA 699



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRL 256
           D C AY+DD++V++R + +    L  + +RL
Sbjct: 540 DICLAYLDDVIVFARTSEEMLHRLEAVLQRL 570



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/25 (60%), Positives = 16/25 (64%)
 Frame = +3

Query: 3    TIDLVKAYQQIPVAPEDICKTAIIT 77
            T+DL   Y QI VAPE   KTA IT
Sbjct: 1544 TLDLRTGYWQIAVAPESREKTAFIT 1568


>SB_33701| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 974

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 24/73 (32%), Positives = 43/73 (58%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I +N  K      EV F+G+ +SADG +P  +++Q +++ P P   Q ++R + M NY +
Sbjct: 306 IKLNKEKLKLRCAEVKFIGHVVSADGLKPDPDKLQGIEEMPTPTNKQDIKRLLVMANYLQ 365

Query: 448 RFLRNAAKLQAPL 486
           +F  N ++  AP+
Sbjct: 366 KFAPNLSEAAAPM 378



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 16/52 (30%), Positives = 26/52 (50%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +D    +  I +  E    T   TP+G Y +  M FG+  A + FQR +++A
Sbjct: 209 VDAKNGFWHIQLDDESSFLTTFGTPWGRYRWTRMPFGIAPAPEEFQRRLEQA 260


>SB_28310| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1051

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 23/75 (30%), Positives = 45/75 (60%)
 Frame = +1

Query: 262 YGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNY 441
           Y + +N  KC     +V+++G+ +  DG +P  E+++A+++   P  ++ LR F+G + Y
Sbjct: 516 YNLKLNKGKCQVRQKQVSYVGHVLRKDGLKPDPEKVRAVEEMQPPTNLKELRTFLGFIQY 575

Query: 442 YRRFLRNAAKLQAPL 486
             +FL N + + APL
Sbjct: 576 LGKFLPNLSTVSAPL 590



 Score = 35.5 bits (78), Expect = 0.040
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           ID    Y QI +  E        +PFG Y +  + FG+++A + FQR I +
Sbjct: 427 IDASSGYWQIKLDEESSKLCTFNSPFGRYRYLRLPFGVKSASEVFQRSISQ 477


>SB_21429| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 840

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 31/70 (44%), Positives = 41/70 (58%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRT 182
           T+DL   Y Q+ ++ +D  KTA+ TPFGL+EF  M FGL NA  TFQR ++      LR 
Sbjct: 740 TLDLQSGYLQVCISEKDQPKTAMTTPFGLFEFTRMPFGLTNAPATFQRLMEH----CLRD 795

Query: 183 LTTY*CIPVM 212
           L    C+  M
Sbjct: 796 LNYNTCVVYM 805


>SB_23051| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2141

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 25/78 (32%), Positives = 44/78 (56%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            I + G+ +NP +C F   ++ +LG  I  +G +    +++A+    +P+ +  LRRF+GM
Sbjct: 1262 ITEIGMTLNPDQCKFSEKKIEYLGQVIDNEGIKKNPAKVKAIVHMDVPRDIPSLRRFLGM 1321

Query: 433  VNYYRRFLRNAAKLQAPL 486
            VN   +F  N A+   PL
Sbjct: 1322 VNQLMKFCPNLAEKTQPL 1339



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 17/51 (33%), Positives = 30/51 (58%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +D    + Q+P++ E    T  ITPFG Y F  + +G+ +A + FQ+ +D+
Sbjct: 1176 LDANSGFHQVPLSEESAKLTTFITPFGRYMFRRLPYGISSAPEYFQKKMDQ 1226



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +3

Query: 534  WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
            W    ++ FN  K+ ++S  ++A   P  E  +  DASS  +GA
Sbjct: 1351 WGKAQDDAFNDLKEEMASERVLALYSPEKETVVSADASSFGLGA 1394


>SB_7810| Best HMM Match : RVT_1 (HMM E-Value=2.8026e-45)
          Length = 732

 Score = 58.0 bits (134), Expect = 7e-09
 Identities = 31/70 (44%), Positives = 41/70 (58%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEATIFALRT 182
           T+DL   Y Q+ ++ +D  KTA+ TPFGL+EF  M FGL NA  TFQR ++      LR 
Sbjct: 606 TLDLQSGYLQVCISEKDQPKTAMTTPFGLFEFTRMPFGLTNAPATFQRLMEH----CLRD 661

Query: 183 LTTY*CIPVM 212
           L    C+  M
Sbjct: 662 LNYNTCVVYM 671



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/34 (35%), Positives = 20/34 (58%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSER 366
           G+ + P+KC      V  LG+ +SA+G +P  E+
Sbjct: 699 GLKLKPSKCKLFQTRVRCLGHVVSAEGIEPDPEK 732


>SB_3054| Best HMM Match : RVT_1 (HMM E-Value=1.6e-09)
          Length = 829

 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 26/51 (50%), Positives = 35/51 (68%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           T+DL   Y Q+ ++ +D  KTA+ TPFGL+EF  M FGL NA  TFQR ++
Sbjct: 544 TLDLQSGYLQVCISEKDQPKTAMTTPFGLFEFTRMPFGLTNAPATFQRLME 594


>SB_21960| Best HMM Match : rve (HMM E-Value=4e-23)
          Length = 1109

 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 25/76 (32%), Positives = 44/76 (57%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++ + +NP K  F    +T+LGN +SADG     E+++A+ + P P  + G++R IG+V 
Sbjct: 445 EHNLKLNPKKLKFKLDRLTYLGNVLSADGISADPEKVKAICEMPQPVDIAGVQRLIGVVT 504

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  + L   + +  PL
Sbjct: 505 YLSKSLPQLSTVAEPL 520



 Score = 31.1 bits (67), Expect = 0.86
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +D    + Q+ +       T   TP+G Y +    FG+++A + FQR I+E
Sbjct: 351 VDAKDRFLQVVLDEPSSYLTTFWTPYGRYRWLRTPFGIKSAPEEFQRRINE 401


>SB_24668| Best HMM Match : RVT_1 (HMM E-Value=0.4)
          Length = 523

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 21/60 (35%), Positives = 39/60 (65%)
 Frame = +1

Query: 307 EVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPL 486
           EV F+G+ +S DG +P  +++Q +++ P P   Q ++R +GM NY ++F  N ++  AP+
Sbjct: 322 EVKFMGHVVSTDGLKPDPDKLQGIEEMPTPTNKQDIKRLLGMANYLQKFAPNLSEAAAPM 381


>SB_19553| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1744

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 24/81 (29%), Positives = 43/81 (53%)
 Frame = +1

Query: 244  FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
            F+ + + G+ +N +KC +G  ++ F G   S DG  P  ++++ + +   P T   +R  
Sbjct: 1077 FKRLREKGLTLNKSKCKYGKEKLEFFGYVFSKDGISPDPKKVEDVVNLQTPSTASEVRSL 1136

Query: 424  IGMVNYYRRFLRNAAKLQAPL 486
            +GM NY  RF+ + A    PL
Sbjct: 1137 LGMTNYCSRFIPDYATKTEPL 1157



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +DL + Y Q+ +APE    T   T  GL     + FG+ +A + FQ  I E
Sbjct: 994  LDLNQGYNQLELAPESRYITTFSTHMGLMRCKRLNFGISSAAEIFQNVIRE 1044



 Score = 31.1 bits (67), Expect = 0.86
 Identities = 13/37 (35%), Positives = 24/37 (64%)
 Frame = +2

Query: 185  DDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
            DD+LV+ +   +H  +LR +FKRL+  + L + ++ C
Sbjct: 1057 DDVLVFGKTQEEHDRNLRAVFKRLR-EKGLTLNKSKC 1092


>SB_18532| Best HMM Match : SspH (HMM E-Value=5.7)
          Length = 95

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 23/57 (40%), Positives = 39/57 (68%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           ++  G+ +  +KC+F APEVT+LG+RI  DG  P  E+I+A+++ P P  ++ L+ F
Sbjct: 39  LDKAGVRLKRSKCIFQAPEVTYLGHRIDKDGIHPLDEKIKAIQESPRPSNLKELQAF 95


>SB_14434| Best HMM Match : RVT_1 (HMM E-Value=8e-34)
          Length = 335

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 26/51 (50%), Positives = 34/51 (66%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           ++DL   Y Q+ V  ED  KTA+ TPFGL+EFN M  GL N+  TFQR ++
Sbjct: 117 SLDLQSGYLQVEVEEEDKSKTAMTTPFGLFEFNRMPVGLTNSPATFQRLME 167



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 2/50 (4%)
 Frame = +1

Query: 343 GTQPPSERIQALKDFPL--PQTVQGLRRFIGMVNYYRRFLRNAAKLQAPL 486
           G Q  S++++AL+++    P   + L+ F+G   YYR F+   + +  PL
Sbjct: 214 GGQARSKKVEALEEWRQHPPTNAKDLQTFLGFAGYYRTFVERFSVIAEPL 263



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 10/32 (31%), Positives = 20/32 (62%)
 Frame = +2

Query: 164 DFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           + C AY+DD++V++R   +    L  + +RL+
Sbjct: 176 NICLAYLDDVIVFARTFEEMLHRLEAVLQRLR 207


>SB_17781| Best HMM Match : RVT_1 (HMM E-Value=1.3e-24)
          Length = 460

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 24/81 (29%), Positives = 43/81 (53%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ + + G+ +N +KC +G  ++ F G   S DG  P  ++++ + +   P T   +R  
Sbjct: 227 FKRLREKGLTLNKSKCKYGKEKLEFFGYVFSKDGISPDPKKVEDVVNLQTPSTASEVRSL 286

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +GM NY  RF+ + A    PL
Sbjct: 287 LGMTNYCSRFIPDYATKTEPL 307



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL + Y Q+ +APE    T   T  GL     + FG+ +A + FQ  I E
Sbjct: 144 LDLNQGYNQLELAPESRYITTFSTHMGLMRCKRLNFGISSAAEIFQNVIRE 194



 Score = 31.1 bits (67), Expect = 0.86
 Identities = 13/37 (35%), Positives = 24/37 (64%)
 Frame = +2

Query: 185 DDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           DD+LV+ +   +H  +LR +FKRL+  + L + ++ C
Sbjct: 207 DDVLVFGKTQEEHDRNLRAVFKRLR-EKGLTLNKSKC 242


>SB_7961| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1957

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 24/74 (32%), Positives = 44/74 (59%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +++ G+ +N  KC F  P++ F G+ +SA G  P  E+I A+ +   PQ V  +R F+ +
Sbjct: 1319 LQEKGLTVNGDKCQFRLPKLKFFGHELSAQGITPSEEKIAAIVNARPPQNVFKVRSFVQL 1378

Query: 433  VNYYRRFLRNAAKL 474
            V Y  +F+ N +++
Sbjct: 1379 VQYSAKFIPNVSQI 1392



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 12/37 (32%), Positives = 21/37 (56%)
 Frame = +2

Query: 185  DDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
            DD++VY  D  +H A+L  +  RL+  + L +  + C
Sbjct: 1296 DDLIVYGTDLAEHDANLHKVLSRLQ-EKGLTVNGDKC 1331


>SB_51136| Best HMM Match : Lac_bphage_repr (HMM E-Value=2.1)
          Length = 240

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 26/81 (32%), Positives = 45/81 (55%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+     G  +N  K     PEV+F+G+ IS  G +P   ++Q ++  P P+  + ++R 
Sbjct: 55  FEKCRAKGFRLNKDKRRLRLPEVSFMGHLISEKGLKPDPAKVQGVQGMPEPKNKKDVKRL 114

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           + MVNY +RF  N + + AP+
Sbjct: 115 MRMVNYLQRFAPNLSNVSAPI 135


>SB_39090| Best HMM Match : zf-piccolo (HMM E-Value=0.81)
          Length = 245

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 27/91 (29%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRRFIGMVN 438
           G+ + P+KC      V  LG+ +SA+G +P  E++  L ++    P+  + L+ F+G  +
Sbjct: 54  GLKLKPSKCKLFQTRVRCLGHVVSAEGIEPDPEKVAPLHEWLSNPPKNTKELQTFLGFAS 113

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRS 531
           YYR F++N +K+  PL   ++    K   +S
Sbjct: 114 YYRSFVKNFSKVAEPLRQLLITGPAKKHKQS 144



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TWT E +  F      L+S+ ++ +P       L  DAS S +GA
Sbjct: 151 TWTSECQSAFETLISHLTSSPILGYPDFELPFILHIDASGSGLGA 195


>SB_13555| Best HMM Match : B5 (HMM E-Value=1.4)
          Length = 369

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 25/76 (32%), Positives = 44/76 (57%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++ + +NP K  F    VT+LG+ +SAD      E+++A+ + P P  + G++R IG+V 
Sbjct: 128 EHNLKLNPKKLKFKLDRVTYLGHVLSADEISADPEKVKAICEMPPPVDIVGVKRLIGVVT 187

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +FL   + +  PL
Sbjct: 188 YLSKFLPQLSTVTEPL 203


>SB_5144| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1015

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 26/80 (32%), Positives = 42/80 (52%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q  +D+ I  N  KC F   E+ F G+  +  G +P  ++++A+KD   P+  + +R F+
Sbjct: 420 QRAKDHRITFNGEKCEFEKQEIEFFGHIFTNKGLRPAPDKVRAVKDSERPEDKEAVRSFL 479

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GM  Y   F+   A   APL
Sbjct: 480 GMAGYLDNFISAYATKAAPL 499



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +2

Query: 170 CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           C    DDIL+  RD  +HA  L+T+ +R K
Sbjct: 394 CINRRDDILIGGRDEAEHAETLKTVLQRAK 423


>SB_663| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2028

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 27/91 (29%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRRFIGMVN 438
           G+ + P+KC      V  LG+ +SA+G +P  E++  L ++    P+  + L+ F+G  +
Sbjct: 552 GLKLKPSKCKLFQTRVRCLGHVVSAEGIEPDPEKVAPLHEWLSNPPKNTKELQTFLGFAS 611

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRS 531
           YYR F++N +K+  PL   ++    K   +S
Sbjct: 612 YYRSFVKNFSKVAEPLRQLLITGPAKKHKQS 642



 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 22/42 (52%), Positives = 28/42 (66%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNA 128
           T+DL   Y Q+ ++  D  KTA+ TPFGL+EF  M FGL NA
Sbjct: 460 TLDLQSGYLQVCISEXDXPKTAMTTPFGLFEFTRMPFGLTNA 501



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TWT E +  F      L+S+ ++ +P       L  DAS S +GA
Sbjct: 649 TWTSECQSAFETLISHLTSSPILGYPDFELPFILHIDASGSGLGA 693


>SB_57833| Best HMM Match : RnaseH (HMM E-Value=0.18)
          Length = 366

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 27/91 (29%), Positives = 50/91 (54%), Gaps = 2/91 (2%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRRFIGMVN 438
           G+ + P+KC      V  LG+ +SA+G +P  E++  L ++    P+  + L+ F+G  +
Sbjct: 15  GLKLKPSKCKLFQTRVRCLGHVVSAEGIEPDPEKVAPLHEWLSNPPKNTKELQTFLGFAS 74

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRS 531
           YYR F++N +K+  PL   ++    K   +S
Sbjct: 75  YYRSFVKNFSKVAEPLRQLLITGPAKKHKQS 105



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TWT E +  F      L+S+ ++ +P       L  DAS S +GA
Sbjct: 112 TWTSECQSAFETLISHLTSSPILGYPDFELPFILHIDASGSGLGA 156


>SB_19811| Best HMM Match : RVT_1 (HMM E-Value=3.5e-32)
          Length = 670

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 28/74 (37%), Positives = 43/74 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP   TV  L+RF 
Sbjct: 458 QRLKDVGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPQHTTVTELQRFN 516

Query: 427 GMVNYYRRFLRNAA 468
           GM+ ++     N A
Sbjct: 517 GMMCWHTTIQTNEA 530



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 374 LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 420


>SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1150

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 27/50 (54%), Positives = 32/50 (64%)
 Frame = +3

Query: 3    TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFI 152
            TIDL  AY Q+ V P D  KTA  +P GL+E+N M F L NA  TFQR +
Sbjct: 1080 TIDLASAYNQVEVHPADRHKTAFTSPMGLFEYNRMPFCLCNAPATFQRLM 1129


>SB_4361| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 790

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 26/66 (39%), Positives = 41/66 (62%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF 
Sbjct: 104 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRFN 162

Query: 427 GMVNYY 444
            ++ +Y
Sbjct: 163 DVLAHY 168



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 20  LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 66


>SB_4267| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 297

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 27/91 (29%), Positives = 49/91 (53%), Gaps = 2/91 (2%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRRFIGMVN 438
           G+ + P+KC      V  LG+ +SA+G +P  E++  L ++    P+  + L+ F+G  +
Sbjct: 15  GLKLKPSKCKLFQTRVRCLGHVVSAEGIEPDPEKVAPLHEWLSNPPKNTKELQTFLGFAS 74

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVKVSHRS 531
           YYR F+ N +K+  PL   ++    K   +S
Sbjct: 75  YYRSFVENFSKVAEPLRQLLITGPAKKHKQS 105



 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/45 (33%), Positives = 22/45 (48%)
 Frame = +3

Query: 531 TWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TWT E +  F      L+S+ ++ +P       L  DAS S +GA
Sbjct: 112 TWTSECQSAFETLISHLTSSPILGYPDFELPFILHIDASGSGLGA 156


>SB_39524| Best HMM Match : rve (HMM E-Value=9.1e-17)
          Length = 754

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 24/76 (31%), Positives = 44/76 (57%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++ + +NP K  F    +T+LG+ +SADG     E+++A+ +   P  + G++R IG+V 
Sbjct: 342 EHNLKLNPKKLKFKLDRLTYLGDFLSADGISADPEKVKAICEMAQPVDIAGVQRLIGVVT 401

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +FL   + +  PL
Sbjct: 402 YMSKFLPQLSTVAEPL 417


>SB_7045| Best HMM Match : rve (HMM E-Value=3.8e-22)
          Length = 1213

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 24/76 (31%), Positives = 44/76 (57%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++ + +NP K  F    +T+LG+ +SADG     E+++A+ +   P  + G++R IG+V 
Sbjct: 545 EHNLKLNPKKLKFKLDRLTYLGDFLSADGISADPEKVKAICEMAQPVDIAGVQRLIGVVT 604

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +FL   + +  PL
Sbjct: 605 YMSKFLPQLSTVAEPL 620



 Score = 31.1 bits (67), Expect = 0.86
 Identities = 15/51 (29%), Positives = 26/51 (50%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +D    + Q+ +       T   TP+G Y +    FG+++A + FQR I+E
Sbjct: 451 VDAKDRFLQVVLDEPSSYLTTFWTPYGRYRWLRTPFGIKSAPEEFQRRINE 501


>SB_28190| Best HMM Match : RVT_thumb (HMM E-Value=6.2)
          Length = 315

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  I  N  K  +   +V+++G  +S  G  P   ++ A+ + P P+  + L+R +GM+N
Sbjct: 42  DRNIRFNKEKIQYRLDKVSYMGEVVSEKGFTPDPSKVSAIFNMPTPKCKKDLQRLLGMIN 101

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +++ N A+L APL
Sbjct: 102 YLSKYVANMAELTAPL 117


>SB_24170| Best HMM Match : rve (HMM E-Value=0.61)
          Length = 768

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 24/76 (31%), Positives = 43/76 (56%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  I  N  K  +   +V+++G  +S  G  P   ++ A+ + P P+  + L+R +GM+N
Sbjct: 255 DRNIRFNKEKIQYRLDKVSYMGEVVSEKGFTPDPSKVSAIFNMPTPKCKKDLQRLLGMIN 314

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +++ N A+L APL
Sbjct: 315 YLSKYVANMAELTAPL 330


>SB_56337| Best HMM Match : RVT_1 (HMM E-Value=1.7e-23)
          Length = 846

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 23/81 (28%), Positives = 43/81 (53%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ + + G+ +N +KC +G  ++ F G   S +G  P  ++++ + +   P T   +R  
Sbjct: 484 FKRLREKGLTLNKSKCEYGKEKLEFFGYVFSKNGISPDPKKVEDVVNLQTPSTASEVRSL 543

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +GM NY  RF+ + A    PL
Sbjct: 544 LGMTNYCSRFIPDYATKTEPL 564



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL + Y Q+ +APE    T   T  GL  +  + FG+ +A + FQ  I E
Sbjct: 401 LDLNQGYNQLELAPESRYITTFSTHMGLMRYKRLNFGISSAAEIFQNVIRE 451



 Score = 31.1 bits (67), Expect = 0.86
 Identities = 13/37 (35%), Positives = 24/37 (64%)
 Frame = +2

Query: 185 DDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           DD+LV+ +   +H  +LR +FKRL+  + L + ++ C
Sbjct: 464 DDVLVFGKTQEEHNRNLRAVFKRLR-EKGLTLNKSKC 499


>SB_19469| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.00048)
          Length = 1347

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 26/73 (35%), Positives = 42/73 (57%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I +N  K VF   EV FLG+ ++++G +P  E+++A+     P  V+G RR  GMV Y  
Sbjct: 74  IKLNHQKSVFKTTEVEFLGHVVTSEGLKPDMEKVKAILKMENPTDVEGARRVQGMVTYLA 133

Query: 448 RFLRNAAKLQAPL 486
           +FL   + +  P+
Sbjct: 134 KFLPQLSTVMDPI 146


>SB_6210| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 372

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 23/76 (30%), Positives = 43/76 (56%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           ++ + +NP K       VT++G+ +SADG     E+++A+ + P P  + G++R IG+V 
Sbjct: 227 EHNLKLNPKKLKIKLERVTYIGHVLSADGISADPEKVKAICEMPQPVDIAGVQRLIGVVT 286

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +F    + +  PL
Sbjct: 287 YLSKFFPQLSTVAEPL 302



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/32 (37%), Positives = 21/32 (65%)
 Frame = +3

Query: 63  TAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T   TP+G + +  M FG+++A + FQR I++
Sbjct: 152 TTFCTPYGRHRWLRMPFGIKSAPEEFQRRINK 183


>SB_12920| Best HMM Match : zf-CCHC (HMM E-Value=6.2e-05)
          Length = 845

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 30/79 (37%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQA-LKDFPLPQTVQGLRRFIG 429
           +E   + +NP KC F   +V F+G  +S     P SER++A LK  P P +   +R F+G
Sbjct: 492 LEQRNLTLNPDKCSFRMNKVVFMGLLLSKYRIGPTSERVRAVLKAIP-PTSASEVRSFLG 550

Query: 430 MVNYYRRFLRNAAKLQAPL 486
           MV +  RF+ N A +  PL
Sbjct: 551 MVGFSSRFIPNFATIAEPL 569



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 16/48 (33%), Positives = 26/48 (54%)
 Frame = +3

Query: 522 TPITWTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           TP+ W  E +  F   K +L  A ++A+   +A+  + TDAS   +GA
Sbjct: 577 TPLKWEGEQQSSFECLKRALVEAPVLAYFDRDADTSVVTDASPVGLGA 624


>SB_45442| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1103

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 23/73 (31%), Positives = 44/73 (60%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I  N +K  +   +V+++G  +S +G  P   ++ A+   P+PQ  + L+R +GM+NY  
Sbjct: 490 IRFNKSKIQYRLDKVSYMGEVVSNNGFTPDPAKVSAILKMPVPQCKKDLQRLLGMINYLS 549

Query: 448 RFLRNAAKLQAPL 486
           +++ + A+L APL
Sbjct: 550 KYIPSMAELTAPL 562



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +3

Query: 75  TPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           TPFG + F  M FG+  A +  Q+ ++E
Sbjct: 422 TPFGRFRFCRMPFGISCASEVAQKMVEE 449


>SB_58082| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1200

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 24/83 (28%), Positives = 45/83 (54%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           +A++   + +N +K +     +  LG  +      P  ER++ L++FP PQ+ Q L+R +
Sbjct: 489 EAVQRRNLTLNESKTIESKSSINILGYCVGRGVITPDQERLRPLQEFPPPQSSQSLKRVV 548

Query: 427 GMVNYYRRFLRNAAKLQAPLVNA 495
           GM+ YY +++ N +    PL  A
Sbjct: 549 GMLAYYAKWIPNFSDKIQPLSQA 571



 Score = 38.3 bits (85), Expect = 0.006
 Identities = 19/52 (36%), Positives = 26/52 (50%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           T DL  AY Q+P+   D   T       LY+F  + FG+ N    FQR +D+
Sbjct: 402 TFDLKSAYHQVPIKETDRKYTGFEANGRLYQFRRIPFGVTNGVAVFQRAMDK 453


>SB_17842| Best HMM Match : RVT_1 (HMM E-Value=2.2e-29)
          Length = 1167

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I +N  K VF   EV FLG+ ++++G +P  ++++A+     P  V+G RR  GMV Y  
Sbjct: 602 IKLNHQKSVFKTTEVEFLGHVVTSEGLKPDMKKVEAILKMENPTDVEGARRVQGMVTYLA 661

Query: 448 RFLRNAAKLQAPL 486
           +FL   + +  P+
Sbjct: 662 KFLPQLSTVMDPI 674


>SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2396

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 28/78 (35%), Positives = 43/78 (55%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            I+D G+ +N +KC F    + FL + I   G      +  A++ +P+P TV  L+RF+GM
Sbjct: 2196 IQDAGMTLN-SKCEFNKRSIKFLAHIIDGSGIYVDPSKTDAIR-YPVPTTVTELQRFLGM 2253

Query: 433  VNYYRRFLRNAAKLQAPL 486
            VN   +F+   A L  PL
Sbjct: 2254 VNRVAKFVPRLADLNCPL 2271



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 17/47 (36%), Positives = 27/47 (57%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    + Q+P+  +    T  ITPFG + FN + FG+ +A + FQR
Sbjct: 2110 LDANSGFWQVPLDEQLKLLTTFITPFGRFCFNRLPFGISSAPEFFQR 2156


>SB_48350| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 883

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I +N  K VF   EV FLG+ ++++G +P  ++++A+     P  V+G RR  GMV Y  
Sbjct: 217 IKLNHQKSVFKTTEVEFLGHVVTSEGLKPDMKKVEAILKMENPTDVEGARRVQGMVTYLA 276

Query: 448 RFLRNAAKLQAPL 486
           +FL   + +  P+
Sbjct: 277 KFLPQLSTVMDPI 289


>SB_39948| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 727

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 25/73 (34%), Positives = 42/73 (57%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I +N  K VF   EV FLG+ ++++G +P  ++++A+     P  V+G RR  GMV Y  
Sbjct: 118 IKLNHQKSVFKTTEVEFLGHVVTSEGLKPDMKKVEAILKMENPTDVEGARRVQGMVTYLA 177

Query: 448 RFLRNAAKLQAPL 486
           +FL   + +  P+
Sbjct: 178 KFLPQLSTVMDPI 190


>SB_31972| Best HMM Match : RVT_1 (HMM E-Value=2.4e-14)
          Length = 1242

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 23/81 (28%), Positives = 41/81 (50%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ + + G+ +N  KC +G  ++ F G   S DG  P  ++++ + +     T   +R  
Sbjct: 579 FKRLREKGLTLNKGKCEYGKEKLEFFGYVFSKDGISPDPKKVEDVVNLQTQSTASEVRSL 638

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +GM NY  RF+ + A    PL
Sbjct: 639 LGMTNYCSRFIPDYATKTEPL 659



 Score = 31.9 bits (69), Expect = 0.49
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +2

Query: 122 QRRPNVSKIYRRSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           QR P   +      D      DD+LV+ +   +H  +LR +FKRL+  + L + +  C
Sbjct: 538 QRFPECIRETLEDIDGAINISDDVLVFGKTQEEHDRNLRAVFKRLR-EKGLTLNKGKC 594



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGL 119
           +DL + Y Q+ +APE    T   T  GL  +  + FG+
Sbjct: 497 LDLNQGYNQLELAPESRYITTFSTHMGLMRYKRLNFGI 534


>SB_21980| Best HMM Match : RVT_1 (HMM E-Value=1.5e-35)
          Length = 212

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 25/59 (42%), Positives = 37/59 (62%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF
Sbjct: 153 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRF 210



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 69  LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 115


>SB_17670| Best HMM Match : RVT_1 (HMM E-Value=6.1e-25)
          Length = 1271

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 23/81 (28%), Positives = 41/81 (50%)
 Frame = +1

Query: 244 FQAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           F+ + + G+ +N  KC +G  ++ F G   S DG  P  ++++ + +     T   +R  
Sbjct: 573 FKRLREKGLTLNKGKCEYGKEKLEFFGYVFSKDGISPDPKKVEDVVNLQTQSTASEVRSL 632

Query: 424 IGMVNYYRRFLRNAAKLQAPL 486
           +GM NY  RF+ + A    PL
Sbjct: 633 LGMTNYCSRFIPDYATKTEPL 653



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 18/51 (35%), Positives = 27/51 (52%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           +DL + Y Q+ +APE    T   T  GL  +  + FG+ +A + FQ  I E
Sbjct: 490 LDLNQGYNQLELAPESRYITTFSTHMGLMRYKRLNFGISSAAEIFQNVIRE 540



 Score = 30.7 bits (66), Expect = 1.1
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +2

Query: 185 DDILVYSRDALQHAAHLRTLFKRLKITESLLIQQNAC 295
           DD+LV+ +   +H  +LR +FKRL+  + L + +  C
Sbjct: 553 DDVLVFGKTQEEHDRNLRAVFKRLR-EKGLTLNKGKC 588


>SB_46816| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1165

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 25/59 (42%), Positives = 37/59 (62%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF
Sbjct: 640 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRF 697



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 556 LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 602


>SB_27419| Best HMM Match : RVT_1 (HMM E-Value=0.00022)
          Length = 399

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  K      EV F+G+ +S DG +P   ++Q +++ P P   Q ++  +GM NY 
Sbjct: 228 GIKLNREKLKLRCAEVKFMGHVVSTDGLKPDPGKLQGIEEMPTPTNKQDIKILLGMANYL 287

Query: 445 RRFLRNAAKLQAPL 486
           ++   N ++  AP+
Sbjct: 288 QKVAPNLSEEAAPM 301



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/52 (28%), Positives = 25/52 (48%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDEA 161
           +D    +  I +  E    T   TP+G Y +  M F +  A + FQR +++A
Sbjct: 132 VDAKNGFWHIQLDDESSFLTTFGTPWGRYRWTRMPFDIAPAPEEFQRRLEQA 183


>SB_18645| Best HMM Match : RVT_1 (HMM E-Value=0.0003)
          Length = 1205

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 26/86 (30%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPL--PQTVQGLRRFIGMVN 438
           G+ + P+KC      V  LG+ +SA+G +P  E+   L ++    P+  + L+ F+G  +
Sbjct: 631 GLKLKPSKCELFQTRVRCLGHVVSAEGIEPDPEKAAPLHEWLSNPPKNTKELQTFLGFAS 690

Query: 439 YYRRFLRNAAKLQAPLVNAIVATEVK 516
           YYR F+ N +K+  PL   ++    K
Sbjct: 691 YYRSFVENFSKVAEPLRQLLITGPAK 716



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 24/45 (53%), Positives = 32/45 (71%)
 Frame = +3

Query: 3   TIDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQT 137
           T+DL   YQQ+ ++ +D  KTA+ TPFGL+EF+ M FGL NA  T
Sbjct: 567 TLDLQSGYQQVCISEKDQPKTAMTTPFGLFEFSRMPFGLTNAPAT 611


>SB_8133| Best HMM Match : RVT_1 (HMM E-Value=1.7e-34)
          Length = 387

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 25/59 (42%), Positives = 37/59 (62%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRF 423
           Q ++D G+ +N  KC F    + FLG+ IS DG +   E+ +A++DFP P TV  L+RF
Sbjct: 328 QRLKDAGVTLNE-KCEFSKQRMKFLGHVISEDGVEADPEKTKAIQDFPRPTTVTELQRF 385



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/47 (40%), Positives = 27/47 (57%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           +D    + QIP+  E    T  +TPFG Y FN + FG+ +A + FQR
Sbjct: 244 LDANSGFWQIPLDEESRLLTTFVTPFGRYCFNRLPFGISSAPEIFQR 290


>SB_23070| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1202

 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 24/66 (36%), Positives = 37/66 (56%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            + + G+ +NP KC FG   +TFLG+ IS  G      +++++     P  V  LRRF+G+
Sbjct: 848  LSESGLTLNPEKCRFGLSSITFLGHVISDKGIAADPGKVESIVKARAPVNVTELRRFLGL 907

Query: 433  VNYYRR 450
            V Y  R
Sbjct: 908  VQYVGR 913


>SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10)
          Length = 1318

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 25/80 (31%), Positives = 39/80 (48%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q  +D GI  N  KC F   E+ F G+  +  G +P  ++++A+K    P   +  R F+
Sbjct: 946  QRAKDNGITFNGEKCEFEKQEIEFFGHVFTNKGLRPAPDKVRAVKKSERPDDKEAARSFL 1005

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            G   Y   F+   A + APL
Sbjct: 1006 GTAGYLDNFISAYATIAAPL 1025



 Score = 31.1 bits (67), Expect = 0.86
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +2

Query: 170  CFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
            C    DDIL+  RD  +HA  LRT+ +R K
Sbjct: 920  CINQRDDILIGGRDDAEHAETLRTVLQRAK 949


>SB_26400| Best HMM Match : RVT_1 (HMM E-Value=1.1e-30)
          Length = 1084

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 26/78 (33%), Positives = 42/78 (53%)
 Frame = +1

Query: 253  IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
            +E  G+ +N  KC F    VTFLG+ + +D  +P   +I+A+ +   P+ +   RRF+GM
Sbjct: 957  LESAGVQLNRDKCEFSKNRVTFLGHVVDSDRVRPDPTKIKAIAE---PKDIDEWRRFLGM 1013

Query: 433  VNYYRRFLRNAAKLQAPL 486
             N   +F    A+   PL
Sbjct: 1014 TNQLGKFSSKLAEASKPL 1031



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 17/47 (36%), Positives = 28/47 (59%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
            +D    + QIP++ E    T  ITPFG + +N + FG+ +A + FQ+
Sbjct: 871  LDANSGFHQIPLSKESTLLTTFITPFGRFSYNRLPFGITSAPEHFQK 917



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +2

Query: 182  VDDILVYSRDALQHAAHLRTLFKRLK 259
            +DD LVY RD  +H   L  + K+L+
Sbjct: 933  IDDTLVYGRDQQEHDERLERVLKKLE 958


>SB_52711| Best HMM Match : rve (HMM E-Value=8.3e-05)
          Length = 1086

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 23/76 (30%), Positives = 42/76 (55%)
 Frame = +1

Query: 259 DYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVN 438
           D  I     K  +   +++++G  +S  G  P   +I A+ + P P+  + L+R +GM+N
Sbjct: 503 DMNIRFKKEKIQYRLDKMSYMGKVVSEKGFTPDPSKISAIFNMPTPKCKKDLQRLLGMIN 562

Query: 439 YYRRFLRNAAKLQAPL 486
           Y  +++ N A+L APL
Sbjct: 563 YLSKYVANMAELTAPL 578


>SB_52661| Best HMM Match : RVT_thumb (HMM E-Value=3)
          Length = 378

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 25/80 (31%), Positives = 44/80 (55%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           Q   + GI  NP KC     E++F G+ IS+ G +   ++I+A+ +     ++  L+ F+
Sbjct: 43  QRAHETGIRFNPDKCKIACTELSFFGHVISSSGLKVDPKKIEAIINMDPSTSLTDLQTFL 102

Query: 427 GMVNYYRRFLRNAAKLQAPL 486
           GMV +  RF+ N + + A L
Sbjct: 103 GMVQFLSRFIPNLSSISAVL 122


>SB_51002| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1888

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 25/80 (31%), Positives = 44/80 (55%)
 Frame = +1

Query: 247  QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
            Q   + GI  NP KC     E++F G+ IS+ G +   ++I+A+ +     ++  L+ F+
Sbjct: 1230 QRAHETGIRFNPDKCKIACTELSFFGHVISSSGLKVDPKKIEAIINMDPSTSLSDLQTFL 1289

Query: 427  GMVNYYRRFLRNAAKLQAPL 486
            GMV +  RF+ N + + A L
Sbjct: 1290 GMVQFLSRFIPNLSSVSAVL 1309



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +3

Query: 6    IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
            +D+   Y  I +  E    T   +P G Y F  + FGL  A   FQR +DE
Sbjct: 1146 VDVRSGYWNIKLDLESSLCTTFNSPHGRYRFCRLPFGLICAQDVFQRKVDE 1196


>SB_43126| Best HMM Match : Myosin_head (HMM E-Value=4.1e-32)
          Length = 898

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 26/78 (33%), Positives = 41/78 (52%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           I+D G+ +N +KC F    + FL + I   G      +  A+  +P+P TV   +RF+GM
Sbjct: 99  IQDAGMTLN-SKCEFNKRSIKFLAHIIDGSGIHVDPSKTDAITRYPVPTTVTEPQRFLGM 157

Query: 433 VNYYRRFLRNAAKLQAPL 486
           VN+  + +   A L  PL
Sbjct: 158 VNHVAKSVPRLADLNGPL 175



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 15/44 (34%), Positives = 26/44 (59%)
 Frame = +3

Query: 534 WTPELEECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGA 665
           W P+ ++ F   K+ LSS+ ++A   P  E  +  DAS++ +GA
Sbjct: 187 WGPDQQQAFQRIKEVLSSSEVLALYSPKRETIIAADASNAGIGA 230


>SB_29817| Best HMM Match : Keratin_B2 (HMM E-Value=6.3)
          Length = 384

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 26/57 (45%), Positives = 33/57 (57%)
 Frame = +1

Query: 316 FLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPL 486
           +LG+ ISADG      +  A+   P P+ V+ LR F GMV YY RFL + A   APL
Sbjct: 180 YLGHIISADGLHQSKTKTGAMTQLPNPENVEQLRSFFGMVQYYSRFLPDLATHLAPL 236


>SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12)
          Length = 1358

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 22/73 (30%), Positives = 43/73 (58%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I  N +K  +   + +++G  +S +G  P   ++ A+   P+PQ  + L+R +GM+NY  
Sbjct: 680 IRFNKSKIQYRLDKSSYMGEVVSNNGFTPDPAKVSAILKMPVPQCKKDLQRLLGMINYLS 739

Query: 448 RFLRNAAKLQAPL 486
           +++ + A+L APL
Sbjct: 740 KYITSMAELTAPL 752


>SB_4914| Best HMM Match : RVT_1 (HMM E-Value=2.5e-16)
          Length = 548

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 22/73 (30%), Positives = 43/73 (58%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I  N +K  +   +V+++G  +S +G  P   ++  +   P+PQ  + L+R +GM+NY  
Sbjct: 201 IRFNKSKIQYRLDQVSYMGEVVSNNGFTPDPAKVSDILKMPVPQCKKDLQRLLGMINYLS 260

Query: 448 RFLRNAAKLQAPL 486
           +++ + A+L APL
Sbjct: 261 KYIPSMAELTAPL 273



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +3

Query: 75  TPFGLYEFNYMTFGLRNAGQTFQRFIDE 158
           TPFG + F  M FG+  A +  Q+ ++E
Sbjct: 133 TPFGRFRFCRMPFGISCASEVAQKMVEE 160


>SB_48126| Best HMM Match : RVT_1 (HMM E-Value=5.5e-39)
          Length = 1510

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/63 (38%), Positives = 37/63 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 599 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 658

Query: 427 GMV 435
            ++
Sbjct: 659 ELL 661



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 515 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 564



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 568 KGIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 602


>SB_13238| Best HMM Match : rve (HMM E-Value=1.1e-13)
          Length = 637

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/73 (32%), Positives = 41/73 (56%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I +N  K VF   EV FLG+ ++++G +P  ++++ +     P  V+G RR  GMV Y  
Sbjct: 187 IKLNHQKSVFKITEVEFLGHVVTSEGLKPDMKKVEVILKMENPTDVEGARRVQGMVTYLA 246

Query: 448 RFLRNAAKLQAPL 486
           +FL   + +  P+
Sbjct: 247 KFLPQLSTVMDPI 259


>SB_4272| Best HMM Match : RVT_1 (HMM E-Value=2e-28)
          Length = 876

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 28/111 (25%), Positives = 58/111 (52%), Gaps = 8/111 (7%)
 Frame = +1

Query: 274 INPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLP------QTVQGLRRFIGMV 435
           +NP K     PEV ++G+ ++  G +P  E+++A+++ P P      + ++ ++RF+G V
Sbjct: 290 LNPKKLKLRLPEVPYIGHLLTPGGVKPDPEKVRAVQEMPRPDGKSKAEKIKAVQRFLGFV 349

Query: 436 NYYRRFLRNAAKLQAPLVNAIVATEVKVSHRSLGH--LSSKNALMPVKIAC 582
           NY  +F+ + A  ++  +  +   E ++ +    H  L   +   PV I C
Sbjct: 350 NYLAKFVPHLAD-ESEQLRRLTDKEAEIKNLVANHPVLRYYDVSKPVTIQC 399



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/46 (30%), Positives = 22/46 (47%)
 Frame = +3

Query: 9   DLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQR 146
           D    + Q+ +  +    T   TPFG Y +  M FG+  A + +QR
Sbjct: 192 DAKNGFWQVKLDEDSSFLTTFWTPFGRYRWLRMPFGIATAPEEYQR 237


>SB_45121| Best HMM Match : rve (HMM E-Value=3.8e-09)
          Length = 1111

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 23/74 (31%), Positives = 41/74 (55%)
 Frame = +1

Query: 265 GIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYY 444
           GI +N  K      EV F+G+ +S DG +P  ++   +++ P P     ++R +GM NY 
Sbjct: 474 GIKLNREKLKLRCAEVKFMGHVVSTDGLKPDPDK--GIEEMPTPTNKHDIKRLLGMANYL 531

Query: 445 RRFLRNAAKLQAPL 486
           ++F  N ++  AP+
Sbjct: 532 QKFAPNLSETAAPM 545



 Score = 29.1 bits (62), Expect = 3.5
 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 1/46 (2%)
 Frame = +3

Query: 534 WTPELE-ECFNACKDSLSSAALVAHPLPNAELGLFTDASSSHVGAC 668
           W  +++ +CF   K  +S A ++    P+ E+ L  DAS   +GAC
Sbjct: 557 WDEQVQGQCFKNVKKIVSQAPVLKFFDPHEEVELQCDASEKGMGAC 602


>SB_19376| Best HMM Match : RVT_1 (HMM E-Value=6.7e-16)
          Length = 274

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 24/73 (32%), Positives = 41/73 (56%)
 Frame = +1

Query: 268 IVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYR 447
           I +N  K VF   EV FLG+ ++++G +P  ++++ +     P  V+G RR  GMV Y  
Sbjct: 189 IKLNHQKSVFKITEVEFLGHVVTSEGLKPDMKKVEVILKMENPTDVEGARRVQGMVTYLA 248

Query: 448 RFLRNAAKLQAPL 486
           +FL   + +  P+
Sbjct: 249 KFLPQLSTVMDPI 261


>SB_50156| Best HMM Match : RVT_1 (HMM E-Value=7.2e-37)
          Length = 493

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 24/60 (40%), Positives = 35/60 (58%)
 Frame = +1

Query: 247 QAIEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFI 426
           + +E YGI +  +KC F    V FLG+ I A+G  P  E+++A+ D P P  V  LR F+
Sbjct: 433 ERLEKYGISLKLSKCSFLEDRVGFLGHVIDAEGVHPSPEKVRAVVDAPAPTNVTELRSFL 492



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +3

Query: 6   IDLVKAYQQIPVAPEDICKTAIITPFGLYEFNYMTFGLRNAGQTFQRFID 155
           +DL  AYQQ+P+  E      + T  GLY++N + FG+ +A   FQ  ID
Sbjct: 349 LDLKHAYQQLPLGEESKKFLTVNTCKGLYQYNRLPFGVASAPAVFQSTID 398



 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +2

Query: 155 RSYDFCFAYVDDILVYSRDALQHAAHLRTLFKRLK 259
           +  D    Y+DDIL+  R+  +H A L  + +RL+
Sbjct: 402 KGIDGVVCYIDDILITGRNDQEHKARLEAVLERLE 436


>SB_48993| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 142

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 20/64 (31%), Positives = 39/64 (60%)
 Frame = +1

Query: 253 IEDYGIVINPAKCVFGAPEVTFLGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGM 432
           +++ G+ +   KCVF   +V +LG++I   G  P  ++++AL     P+ V  L+ ++G+
Sbjct: 78  LDEAGLRLKREKCVFMQDKVVYLGHQIDKTGISPVKDKVEALVKAKTPENVTELKAYLGL 137

Query: 433 VNYY 444
           +NYY
Sbjct: 138 LNYY 141


>SB_17210| Best HMM Match : Op_neuropeptide (HMM E-Value=2.7)
          Length = 240

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 18/56 (32%), Positives = 36/56 (64%)
 Frame = +1

Query: 319 LGNRISADGTQPPSERIQALKDFPLPQTVQGLRRFIGMVNYYRRFLRNAAKLQAPL 486
           +G+ +S DG +P  +++Q +++ P P   Q ++R +GM NY ++F  N ++  AP+
Sbjct: 1   MGHVVSTDGLKPDPDKLQGIEEMPTPTNKQDIKRLLGMANYLQKFAPNLSEAAAPM 56


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,831,420
Number of Sequences: 59808
Number of extensions: 393967
Number of successful extensions: 2479
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 1571
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2439
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1745338465
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -