SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120009.Seq
         (721 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08)                31   1.2  
SB_6324| Best HMM Match : MCM (HMM E-Value=0)                          29   5.0  
SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07)                 28   6.6  
SB_10749| Best HMM Match : DB (HMM E-Value=1.5)                        28   6.6  

>SB_47465| Best HMM Match : EGF_CA (HMM E-Value=2.4e-08)
          Length = 263

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = -2

Query: 171 TFFPSLTCQCRALPLCPRYRQFSQDISGILLC 76
           TF   +  +CR    CPRY Q S+++SG ++C
Sbjct: 108 TFCAYIAGECRCSENCPRYSQ-SRNVSGSIIC 138


>SB_6324| Best HMM Match : MCM (HMM E-Value=0)
          Length = 1592

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 11/43 (25%), Positives = 23/43 (53%)
 Frame = -3

Query: 152  HASVGHCHYAPVIVNFLKTYLAFCCARWPIIFK*FEHIVISVF 24
            H++    HY P+ +N ++ Y+A C  + PI+       ++S +
Sbjct: 981  HSAHPPSHYDPLDMNLMRRYIAACKEKQPIVPGELSDYIVSAY 1023


>SB_20050| Best HMM Match : RVT_1 (HMM E-Value=1.3e-07)
          Length = 493

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = +3

Query: 546 LCASVKLTPFKPMRPPKPMQCWIHPRRANCKVTRPRNNYSDP 671
           +C S   +  +PM P   +  W+  RRA    TRP  NY+ P
Sbjct: 40  VCHSRHRSTIRPMVPGGLLSMWLLERRAPTHKTRP--NYTSP 79


>SB_10749| Best HMM Match : DB (HMM E-Value=1.5)
          Length = 616

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 3/39 (7%)
 Frame = +3

Query: 159 LEKMFH--EQCI-QRWRREHTRDPFNRAIKYYFNFPQKR 266
           LE +FH  + C+   W RE  RDP + AI Y +     R
Sbjct: 549 LETIFHTTQNCVCDVWFRERYRDPVSGAISYNYRMMYSR 587


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,577,810
Number of Sequences: 59808
Number of extensions: 444505
Number of successful extensions: 1068
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 992
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1061
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1913853903
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -