SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120008.Seq
         (681 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41)                 144   6e-35
SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)              99   2e-21
SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)              96   3e-20
SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)              95   6e-20
SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)               95   6e-20
SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.)              73   2e-13
SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)              70   2e-12
SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)            70   2e-12
SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)            70   2e-12
SB_17563| Best HMM Match : DEAD (HMM E-Value=0)                        69   5e-12
SB_2247| Best HMM Match : DEAD (HMM E-Value=0)                         69   5e-12
SB_52320| Best HMM Match : DEAD (HMM E-Value=0)                        67   1e-11
SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)                  64   1e-10
SB_43842| Best HMM Match : RNB (HMM E-Value=0)                         62   5e-10
SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)              61   7e-10
SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17)                  61   9e-10
SB_37351| Best HMM Match : DEAD (HMM E-Value=0)                        60   1e-09
SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6)                      60   2e-09
SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)              58   9e-09
SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.)              56   3e-08
SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)                  54   1e-07
SB_9558| Best HMM Match : DEAD (HMM E-Value=0)                         52   3e-07
SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)              47   2e-05
SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42)               45   5e-05
SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069)                   44   2e-04
SB_32980| Best HMM Match : DEAD (HMM E-Value=0)                        44   2e-04
SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07)                  42   3e-04
SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.)              42   6e-04
SB_53656| Best HMM Match : No HMM Matches (HMM E-Value=.)              37   0.013
SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22)            37   0.013
SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)              34   0.12 
SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)                  33   0.28 
SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8)                      32   0.37 
SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27)                  31   0.65 
SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057)                   31   0.86 
SB_19286| Best HMM Match : WD40 (HMM E-Value=1.3)                      31   0.86 
SB_57042| Best HMM Match : WD40 (HMM E-Value=4.9e-09)                  31   0.86 
SB_50927| Best HMM Match : DEAD (HMM E-Value=3.2e-06)                  30   1.5  
SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)                    30   2.0  
SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   2.0  
SB_36508| Best HMM Match : WD40 (HMM E-Value=0.006)                    29   2.6  
SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)            29   2.6  
SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0)                    29   3.5  
SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   3.5  
SB_24613| Best HMM Match : Ctr (HMM E-Value=0.73)                      28   6.1  

>SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41)
          Length = 690

 Score =  144 bits (349), Expect = 6e-35
 Identities = 66/84 (78%), Positives = 73/84 (86%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GRLID LE   TNL+RCTYLVLDEADRMLDMGFEPQIR II+QIRPDRQTLMWSATWPKE
Sbjct: 191 GRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKE 250

Query: 437 VKKLAEDYLGDYIQINIGSLQLSA 508
           V+ LA D+L DY+ I +GSL L+A
Sbjct: 251 VQGLAHDFLSDYVHITVGSLGLTA 274



 Score =  108 bits (259), Expect = 5e-24
 Identities = 50/77 (64%), Positives = 61/77 (79%)
 Frame = +3

Query: 24  YILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPK 203
           +ILP IVHIN+QP ++ GDGPI LVL PTRELAQQ+Q+VA   G    +R+TC++GGAPK
Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPK 172

Query: 204 REQARDLERGVEIVIAT 254
             Q R+LERGVEI IAT
Sbjct: 173 GPQIRELERGVEICIAT 189



 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 21/46 (45%), Positives = 30/46 (65%)
 Frame = +1

Query: 508 NHNILQIVDICQEHEKENKLNVLLQEIGQSQEPGAKTIIFVETKRK 645
           NH ILQIVD+C++HEKE+ +   +   G       +T+IF ETKR+
Sbjct: 275 NHKILQIVDVCEDHEKEHNVGSFIG--GIVILSSLQTLIFTETKRR 318


>SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1170

 Score =   99 bits (238), Expect = 2e-21
 Identities = 45/82 (54%), Positives = 65/82 (79%), Gaps = 4/82 (4%)
 Frame = +2

Query: 257  GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI----RPDRQTLMWSAT 424
            GRL DF+EKG  +L+   +L+LDEADRMLDMGFEP IR+I+E +    + +RQTLM+SAT
Sbjct: 847  GRLTDFIEKGKVSLKGLQFLILDEADRMLDMGFEPAIRRIVESMGMPDKSERQTLMFSAT 906

Query: 425  WPKEVKKLAEDYLGDYIQINIG 490
            +P+E+++LA D+L DY+ + +G
Sbjct: 907  FPEEIQRLAGDFLNDYLFLTVG 928



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3    GSGKTLAYILPAIVHINN----QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYV 170
            GSGKT A++LP +  + N             P A+ +APTRELA QI   A  F H + +
Sbjct: 758  GSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGTML 817

Query: 171  RNTCVFGGAPKREQARDLERGVEIVIAT 254
            R    +GG     Q R L+ G  +++ T
Sbjct: 818  RPVVCYGGVSVSHQLRQLQSGCNLLVGT 845


>SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1375

 Score = 95.9 bits (228), Expect = 3e-20
 Identities = 51/99 (51%), Positives = 68/99 (68%), Gaps = 7/99 (7%)
 Frame = +2

Query: 221  LGEGSRNSHCY---SGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ-I 388
            L E  RN H      GRL+D +++G   L    +LVLDEADRMLDMGFEPQIR+I++Q  
Sbjct: 969  LRELDRNCHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRMLDMGFEPQIRRIVDQDS 1028

Query: 389  RPD---RQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
             P    RQTLM+SAT+PKE++ LA D+L +YI + +G +
Sbjct: 1029 MPKTGIRQTLMFSATFPKEIQMLARDFLENYIFLAVGKV 1067



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75   GDGPIALVLAPT-RELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIA 251
            G G  A  L P    +  +      DF + S  R   V+GGA    Q R+L+R   +++A
Sbjct: 922  GSGKTAAFLIPILSRIYMEGPPAPPDFSYRSLCRPCVVYGGADIGSQLRELDRNCHLLVA 981

Query: 252  T 254
            T
Sbjct: 982  T 982


>SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 790

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 45/84 (53%), Positives = 57/84 (67%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A++ PA+VHI +QP ++ GDGPI L+ APTREL QQI   A  FG    +    
Sbjct: 564 GSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVA 623

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           VFGG  K EQ++ L+ G EIV+AT
Sbjct: 624 VFGGGNKYEQSKALQEGAEIVVAT 647



 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 40/95 (42%), Positives = 51/95 (53%)
 Frame = +2

Query: 212 SPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           S  L EG+       GRLID ++   TNL R TYLV DEADRM DMGF            
Sbjct: 634 SKALQEGAEIVVATPGRLIDHVKAKATNLHRVTYLVFDEADRMFDMGF------------ 681

Query: 392 PDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSL 496
                L++SAT+ K+V+ L  D L D +++ IG L
Sbjct: 682 ----ALLFSATFKKKVEHLCRDILVDPVRVVIGEL 712


>SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 592

 Score = 94.7 bits (225), Expect = 6e-20
 Identities = 53/101 (52%), Positives = 65/101 (64%), Gaps = 11/101 (10%)
 Frame = +2

Query: 221 LGEGSRNSHCYSGRLIDFLEKGT---TNLQRCTYLVLDEADRMLDMGFEPQIRK------ 373
           L  G+    C  GR+ID L       TN QRCTYLVLDEADRM DMGFEPQI K      
Sbjct: 191 LKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQITKIRYPKV 250

Query: 374 --IIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIG 490
             II+ IRPDRQT+M+SAT+P++++ LA   L   I+I +G
Sbjct: 251 MRIIDCIRPDRQTVMFSATFPRQMEALARKILDKPIEIQVG 291



 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 31/81 (38%), Positives = 43/81 (53%)
 Frame = +3

Query: 12  KTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFG 191
           K  +Y  P  +     P I  G   IA+V+ PTRELA QI +    F   + +R  CV+G
Sbjct: 121 KKNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYG 180

Query: 192 GAPKREQARDLERGVEIVIAT 254
           G    EQ  +L+RG EI++ T
Sbjct: 181 GTGISEQIAELKRGAEIIVCT 201


>SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 797

 Score = 73.3 bits (172), Expect = 2e-13
 Identities = 39/83 (46%), Positives = 55/83 (66%), Gaps = 5/83 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQ----IRPDRQTLMWSAT 424
           GRL DF+ +    L    +L+LDEADRMLD+GF P I K+IE+     +  RQTLM+SAT
Sbjct: 611 GRLQDFVSREKIYLGSIQHLILDEADRMLDLGFGPDIHKLIEESNMTAKESRQTLMFSAT 670

Query: 425 WPKEVKKLAEDYL-GDYIQINIG 490
           +P E++ LA  +L  DY+ + +G
Sbjct: 671 FPDEIQHLAGSFLKPDYLFLAVG 693



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 33/84 (39%), Positives = 45/84 (53%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT AY+LP +  +  Q        P+AL +APTRELA+QI   A  F   + ++   
Sbjct: 526 GSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVCV 585

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
            +GG     QA  LERG   ++ T
Sbjct: 586 CYGGVSVPYQASQLERGCHFLVGT 609


>SB_29417| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 268

 Score = 70.1 bits (164), Expect = 2e-12
 Identities = 29/55 (52%), Positives = 43/55 (78%)
 Frame = +2

Query: 347 MGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINIGSLQLSAI 511
           MGFEP+I+KI+  IRPDRQT+M SATWP  V+++A+ Y+ D +++ +G L L+ I
Sbjct: 1   MGFEPEIKKILLDIRPDRQTVMTSATWPPGVQRMADQYMTDPVRVFVGCLDLNVI 55


>SB_59075| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)
          Length = 445

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 31/66 (46%), Positives = 44/66 (66%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDY 472
           N+    YLVLDEADRM+DMGFE  +R I    +  RQTL++SAT PK+++  A+  L   
Sbjct: 13  NVSPYRYLVLDEADRMIDMGFEEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKP 72

Query: 473 IQINIG 490
           + +N+G
Sbjct: 73  VTVNVG 78


>SB_55073| Best HMM Match : Helicase_C (HMM E-Value=1.3e-19)
          Length = 212

 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 31/66 (46%), Positives = 44/66 (66%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDY 472
           N+    YLVLDEADRM+DMGFE  +R I    +  RQTL++SAT PK+++  A+  L   
Sbjct: 13  NVSPYRYLVLDEADRMIDMGFEEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKP 72

Query: 473 IQINIG 490
           + +N+G
Sbjct: 73  VTVNVG 78


>SB_17563| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 68.5 bits (160), Expect = 5e-12
 Identities = 31/90 (34%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++K   ++ +C  LV+DEAD++L M F+  + +II+ +  +RQ L++SAT+P  
Sbjct: 181 GRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPIS 240

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           V+   E +L    +IN+   L L  +T ++
Sbjct: 241 VRDFKEKHLRKPYEINLMDELTLHGVTQYY 270



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT AY++P +   +      +     ALVL PTRELA Q  Q+  + G
Sbjct: 94  GTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139


>SB_2247| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 439

 Score = 68.5 bits (160), Expect = 5e-12
 Identities = 31/90 (34%), Positives = 57/90 (63%), Gaps = 1/90 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR++D ++K   ++ +C  LV+DEAD++L M F+  + +II+ +  +RQ L++SAT+P  
Sbjct: 181 GRVLDLMKKKLADMSKCQMLVMDEADKLLSMDFKKMLEQIIKHLPENRQILLFSATFPIS 240

Query: 437 VKKLAEDYLGDYIQINI-GSLQLSAITTFF 523
           V+   E +L    +IN+   L L  +T ++
Sbjct: 241 VRDFKEKHLRKPYEINLMDELTLHGVTQYY 270



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG 155
           G+GKT AY++P +   +      +     ALVL PTRELA Q  Q+  + G
Sbjct: 94  GTGKTAAYLVPLLERTDTTKNCIQ-----ALVLVPTRELALQTSQICIELG 139


>SB_52320| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 340

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 38/79 (48%), Positives = 50/79 (63%), Gaps = 3/79 (3%)
 Frame = +2

Query: 248 CYSGRLIDFLEKGTTNLQRCT---YLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWS 418
           C  GRL+  +++ T N   CT    LVLDEADR+LDMGF P +  IIE +  +RQTL++S
Sbjct: 177 CTPGRLLQHMDE-TPNFD-CTSLQILVLDEADRILDMGFAPTLNAIIENLPSERQTLLYS 234

Query: 419 ATWPKEVKKLAEDYLGDYI 475
           AT  + VK LA   L  Y+
Sbjct: 235 ATQTRSVKDLARLSLQSYV 253



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 1/81 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P I  +  Q      DG  ALV++PTRELA Q  +V    G+   +    
Sbjct: 97  GSGKTLAFLIPIIETLWRQKWTSM-DGLGALVISPTRELAYQTFEVLVKIGNKHDLSAGL 155

Query: 183 VFGGAP-KREQARDLERGVEI 242
           + GG   K EQ R ++  + +
Sbjct: 156 IIGGKDLKNEQKRIMKTNIVV 176


>SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36)
          Length = 428

 Score = 64.1 bits (149), Expect = 1e-10
 Identities = 34/71 (47%), Positives = 43/71 (60%), Gaps = 4/71 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGD----GPIALVLAPTRELAQQIQQVAADFGHTSYV 170
           GSGKT A+ +P +V I   P I R +    GP AL+LAPTRELAQQI++    FG    +
Sbjct: 148 GSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGI 207

Query: 171 RNTCVFGGAPK 203
           R   V GGA +
Sbjct: 208 RTVSVIGGADR 218



 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 24/76 (31%)
 Frame = +2

Query: 308 TYLVLDEADRMLDMGFEPQIRKIIE-----QIRPD-------------------RQTLMW 415
           T  V+  ADRM+DMGFEP+++KI+E      ++PD                   RQT+M+
Sbjct: 209 TVSVIGGADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHMGKDKYRQTVMF 268

Query: 416 SATWPKEVKKLAEDYL 463
           +AT P +V++LA++YL
Sbjct: 269 TATMPPQVERLAKNYL 284


>SB_43842| Best HMM Match : RNB (HMM E-Value=0)
          Length = 1238

 Score = 61.7 bits (143), Expect = 5e-10
 Identities = 32/69 (46%), Positives = 45/69 (65%), Gaps = 3/69 (4%)
 Frame = +2

Query: 293 NLQRCTYLVLDEADRMLDMGFEPQIRKII---EQIRPDRQTLMWSATWPKEVKKLAEDYL 463
           +L + TYLV+DE DRML MG E Q+RKI+         RQTL+WSAT P+ +++LA   +
Sbjct: 230 DLYKITYLVMDEPDRMLGMGMEEQLRKIVGLATGTSRARQTLLWSATLPESLERLARSAV 289

Query: 464 GDYIQINIG 490
            + I I +G
Sbjct: 290 LNPITIQVG 298



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 24/43 (55%), Positives = 30/43 (69%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQI 131
           GSGKTLAY LP  + +  + P   GD P+AL+L PTREL QQ+
Sbjct: 119 GSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161


>SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 478

 Score = 61.3 bits (142), Expect = 7e-10
 Identities = 37/128 (28%), Positives = 61/128 (47%), Gaps = 2/128 (1%)
 Frame = +2

Query: 152 WTHILCS*HVCVWWCS*KRASPGLGEGSRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEA 331
           + H+ C  H C+   + +     L EG        GR+ D + +G  N +     VLDEA
Sbjct: 185 YMHVKC--HACIGGTNVREDRMKLEEGVHVVVGTPGRVFDMINRGVLNTRDIKLFVLDEA 242

Query: 332 DRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI--GSLQLS 505
           D ML  GF+ QI  +  ++    Q ++ SAT P +V ++   ++ D ++I +    + L 
Sbjct: 243 DEMLSRGFKDQIYDVFTRLPTSVQVVLLSATMPTDVLEVTNKFMRDVVRILVKREEVTLE 302

Query: 506 AITTFFKL 529
            I  FF L
Sbjct: 303 GIKQFFVL 310



 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG-DGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKT  + +  +  I+     + G D   ALVLAPTRELAQQIQ+V    G   +V+  
Sbjct: 132 GTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCH 191

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
              GG   RE    LE GV +V+ T
Sbjct: 192 ACIGGTNVREDRMKLEEGVHVVVGT 216


>SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17)
          Length = 500

 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 28/82 (34%), Positives = 50/82 (60%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+++ + +   +L      V+DE D ML +GFE Q+++I+E++   RQT+++SAT P  
Sbjct: 264 GRMVEIISRQAVDLTHVIGCVVDEVDTMLQLGFEQQVQQILERLSNRRQTMLFSATIPPS 323

Query: 437 VKKLAEDYLGDYIQINIGSLQL 502
           ++ +A   L   + I+ GS  L
Sbjct: 324 IEAMASRLLNAPVFISAGSPSL 345


>SB_37351| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 688

 Score = 60.5 bits (140), Expect = 1e-09
 Identities = 30/74 (40%), Positives = 48/74 (64%), Gaps = 5/74 (6%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKII----EQIRPDR-QTLMWSA 421
           GR++DF+ +GT +L +  ++VLDE DRMLDMGF   + +++     + R D+ QTL++SA
Sbjct: 204 GRILDFMRQGTLDLSKLKHVVLDEVDRMLDMGFAESVEEVLAASYAEDREDKPQTLLFSA 263

Query: 422 TWPKEVKKLAEDYL 463
           T P      A+ Y+
Sbjct: 264 TLPPWAVNTAKKYM 277



 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 28/85 (32%), Positives = 49/85 (57%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINN-QPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNT 179
           G+GKTL++ LP +  + + +   +RG  P  LV+APTRELA+Q+     +    S +   
Sbjct: 120 GTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQVGNEFENL--KSNLEVY 177

Query: 180 CVFGGAPKREQARDLERGVEIVIAT 254
           C++GG P   Q   +  G+++++ T
Sbjct: 178 CIYGGMPYEPQENAINSGLDVLVGT 202


>SB_37968| Best HMM Match : DEAD (HMM E-Value=3.6)
          Length = 127

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/58 (48%), Positives = 42/58 (72%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           LVLDEADRMLDMGF   IR+++ ++   RQ L++SAT+  ++K LAE  L + ++I +
Sbjct: 7   LVLDEADRMLDMGFIHDIRRVLTKLPAKRQNLLFSATFSDDIKALAEKLLHNPLEIEV 64


>SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 370

 Score = 57.6 bits (133), Expect = 9e-09
 Identities = 31/91 (34%), Positives = 48/91 (52%), Gaps = 2/91 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+ D + +     +    LVLDEAD ML+ GF+ QI  +   + P  Q ++ SAT P E
Sbjct: 124 GRVFDMIRRRNLRTRSIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLLSATLPHE 183

Query: 437 VKKLAEDYLGDYIQINI--GSLQLSAITTFF 523
           + ++   ++ D I+I +    L L  I  FF
Sbjct: 184 ILEMTSKFMTDPIRILVKRDELTLEGIKQFF 214



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 33/84 (39%), Positives = 43/84 (51%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + +  +  I+ Q  +R    P ALVL+PTRELA QIQ+V    G    V+   
Sbjct: 44  GTGKTATFSISVLQAIDTQ--LRE---PQALVLSPTRELANQIQKVVLALGDYMSVQCHA 98

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
             GG    E  R L+ G  IV  T
Sbjct: 99  CIGGTNIGEDIRKLDYGQHIVSGT 122


>SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1448

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 1/67 (1%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQR-CTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPK 433
           GRL+D L+     L +    LV+DEADR+L++GFE ++R+II  +   RQT+++SAT  K
Sbjct: 703 GRLLDHLQNTQGFLYKNLQCLVIDEADRILEIGFEEEMRQIIRILPSKRQTVLFSATQTK 762

Query: 434 EVKKLAE 454
            V+ LA+
Sbjct: 763 NVEDLAK 769



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKTLA+++P +V +  +   +  +G   ++++PTREL+ Q   VA D           
Sbjct: 619 GSGKTLAFLVP-VVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLKHHNFTYGI 677

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG  ++ +A  L++GV ++IAT
Sbjct: 678 IMGGVNRKAEAERLQKGVNLLIAT 701


>SB_34731| Best HMM Match : DEAD (HMM E-Value=3.8e-31)
          Length = 978

 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 33/89 (37%), Positives = 48/89 (53%), Gaps = 5/89 (5%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRG-----DGPIALVLAPTRELAQQIQQVAADFGHTSY 167
           GSGKTLAY+ P +VH   +   R G       P A ++ P RELA QI + A    H + 
Sbjct: 425 GSGKTLAYLAP-LVHRLREDEERHGILARLKRPRACIVVPARELATQILKTAKSLCHHAR 483

Query: 168 VRNTCVFGGAPKREQARDLERGVEIVIAT 254
            R+  + GG  ++    DLE  V++++AT
Sbjct: 484 FRSVGLIGGRKQKWMRDDLESPVDLLVAT 512



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 15/44 (34%), Positives = 23/44 (52%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           G L+ + +K        T+LV+DEAD M D  F+    +I+  I
Sbjct: 514 GTLLKYRQKDRLFFSDLTHLVIDEADTMFDASFKSLTMEILHTI 557


>SB_9558| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 436

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 26/57 (45%), Positives = 38/57 (66%), Gaps = 1/57 (1%)
 Frame = +2

Query: 257 GRLIDFLEK-GTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSAT 424
           GRL D ++   T NL++  +LVLDEADR+LD  F   ++ I + +   RQTL++SAT
Sbjct: 134 GRLADHIKSTDTLNLKKIQFLVLDEADRLLDPSFGDDLKVIFDAVPEKRQTLLFSAT 190



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 31/84 (36%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  + + P      G  A+VL PTRELA QI       G    ++   
Sbjct: 54  GSGKTAAFALPILQKLCDDPY-----GIFAVVLTPTRELAFQIADQFKVLGRPIGLKEAV 108

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG    +QA  L     +VIAT
Sbjct: 109 IVGGLDMMKQALSLANKPHVVIAT 132


>SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 697

 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 35/98 (35%), Positives = 50/98 (51%), Gaps = 14/98 (14%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHIN-------NQPPI-------RRGDGPIALVLAPTRELAQQIQQV 140
           GSGKTLA+ +P I HI         Q P         +G   +AL++APTRELA Q++  
Sbjct: 178 GSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTRELALQVKDH 237

Query: 141 AADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
                  + V+   + GG    +Q R L++  EIV+AT
Sbjct: 238 LVKAAKYTSVKVAAIVGGMAAPKQQRLLKQRPEIVVAT 275



 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +2

Query: 278 EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           EK  +N+Q   YLV+DEADRM++ G   ++  I+E I
Sbjct: 331 EKHVSNIQLLRYLVIDEADRMVEQGHYEELSSILELI 367


>SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42)
          Length = 238

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 31/84 (36%), Positives = 41/84 (48%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+ LP +  + + P         AL+L PTRELA QI +     G    V+   
Sbjct: 11  GSGKTGAFALPILQALLDNP-----QRLFALILTPTRELAFQISEQCEALGSGIGVKCAV 65

Query: 183 VFGGAPKREQARDLERGVEIVIAT 254
           + GG     QA  L +   I+IAT
Sbjct: 66  IVGGIDMMSQALMLAKKPHIIIAT 89



 Score = 38.7 bits (86), Expect = 0.004
 Identities = 22/38 (57%), Positives = 28/38 (73%), Gaps = 2/38 (5%)
 Frame = +2

Query: 257 GRLIDFLE--KGTTNLQRCTYLVLDEADRMLDMGFEPQ 364
           GRLID LE  KG + L+   YLV+DEADR+L+M FE +
Sbjct: 91  GRLIDHLENTKGFS-LRTLKYLVMDEADRILNMDFEKE 127


>SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069)
          Length = 120

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/57 (45%), Positives = 30/57 (52%)
 Frame = +3

Query: 84  PIALVLAPTRELAQQIQQVAADFGHTSYVRNTCVFGGAPKREQARDLERGVEIVIAT 254
           P ALVL+PTRELA QIQ+V    G    V+     GG    E  R L+ G  IV  T
Sbjct: 4   PQALVLSPTRELANQIQKVVLALGDYMSVQCHACIGGTNIGEDIRKLDYGQHIVSGT 60


>SB_32980| Best HMM Match : DEAD (HMM E-Value=0)
          Length = 985

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 21/78 (26%), Positives = 44/78 (56%), Gaps = 2/78 (2%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQTLMWSATWPKE 436
           GR+   +E+     +     +LDEAD++LD  F+ QI  I   +  ++Q + +SAT+P+ 
Sbjct: 140 GRVKYLIEQKYLKTESVRMFILDEADKLLDESFQQQINWIFSALPENKQMMAFSATYPEV 199

Query: 437 VKKLAEDYLGD--YIQIN 484
           +    + Y+ +  ++++N
Sbjct: 200 LANHLKKYMTEPTFVRLN 217



 Score = 28.7 bits (61), Expect = 4.6
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 1/85 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           G+GKT  + + A+ ++     I   +    ++L PTRE+A Q++ V    G   Y    C
Sbjct: 60  GTGKTCVFSVIALENV-----ITESNCIQIIILTPTREIAVQVKDVICAIG-CHYDGLAC 113

Query: 183 -VFGGAPKREQARDLERGVEIVIAT 254
            VF G    E+ +   +   I + T
Sbjct: 114 KVFIGGISLEEDKKALKSCHIAVGT 138


>SB_40196| Best HMM Match : DEAD (HMM E-Value=3.5e-07)
          Length = 456

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 26/88 (29%), Positives = 42/88 (47%), Gaps = 4/88 (4%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRR---GDGPIALVLAPTRELAQQIQQVAAD-FGHTSYV 170
           GSGK LAY+LP I  I      +     +GP+ L+L    +   ++  V  D   +    
Sbjct: 234 GSGKRLAYLLPIIHQITESSVYQELPLANGPLVLILCTNWQNTARVYGVCEDLIRNRRRT 293

Query: 171 RNTCVFGGAPKREQARDLERGVEIVIAT 254
           R   +FGG  + ++   L  G E+++AT
Sbjct: 294 RVQMIFGGGAEEDRIVPLINGCEVLVAT 321


>SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1039

 Score = 41.5 bits (93), Expect = 6e-04
 Identities = 22/64 (34%), Positives = 36/64 (56%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFGHTSYVRNTC 182
           GSGKT A+++P    +          G  AL+L+PTRELA Q Q+   + G  + ++++ 
Sbjct: 328 GSGKTAAFLIPMFEKLQTHTA---KVGIRALILSPTRELALQTQKFIKELGRFTGLKSSV 384

Query: 183 VFGG 194
           + GG
Sbjct: 385 ILGG 388


>SB_53656| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 51

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 16/37 (43%), Positives = 25/37 (67%)
 Frame = +2

Query: 278 EKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           E+  +N+Q   YLV+DEADRM++ G   ++  I+E I
Sbjct: 2   EEHVSNVQLLRYLVIDEADRMVEQGHYEELSSILELI 38


>SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22)
          Length = 1058

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 29/100 (29%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
 Frame = +2

Query: 260 RLIDFL--EKGTTNLQRCTYLVLDEADRMLDM---GFEPQIRKIIEQI-RPDRQTLMWSA 421
           RL+  L  E     L    +L+LDEAD++ +    GF  QI  I +   +PD    ++SA
Sbjct: 266 RLVHLLTQEPPGIELHNVEWLILDEADKLFEEGKDGFREQIATIYQACNKPDIHRGLFSA 325

Query: 422 TWPKEVKKLAEDYLGDYIQINIGSLQLSAITTFFKL*IFV 541
           T    +++ A  +L +++++ +G ++ SA  T  +  +FV
Sbjct: 326 TLSNGIEEWAGLHLDNHVRVTVG-IRNSATATVDQELLFV 364



 Score = 27.9 bits (59), Expect = 8.0
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 3/39 (7%)
 Frame = +3

Query: 24  YILPAIVHINNQPPIRRG---DGPIALVLAPTRELAQQI 131
           Y  P  + +   P +  G    G  A+V++PTRELAQQI
Sbjct: 183 YTTPTPIQMQATPLMAHGPKKSGFRAVVVSPTRELAQQI 221


>SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40)
          Length = 490

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQIQQVAADFG-HTSYVR-N 176
           G+GKT A++L  +  ++   P      P  + L+PT ELA+Q  +VA   G H  +++ N
Sbjct: 152 GTGKTAAFVLTMLSRVDATKPY-----PQVICLSPTYELARQTGKVAEAMGKHCPHIKIN 206

Query: 177 TCVFGGA-PKREQARD 221
             V G   P+ ++  D
Sbjct: 207 YAVRGNQFPRGQKCTD 222


>SB_10917| Best HMM Match : SPRY (HMM E-Value=1.4e-17)
          Length = 635

 Score = 32.7 bits (71), Expect = 0.28
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQI 388
           G+L DF+     +L +  + +LDEAD +L  G    I KI  +I
Sbjct: 144 GKLNDFITTDKISLHQVKFFILDEADGLLAQGNNDLIMKIYNKI 187


>SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8)
          Length = 210

 Score = 32.3 bits (70), Expect = 0.37
 Identities = 15/30 (50%), Positives = 19/30 (63%)
 Frame = +2

Query: 314 LVLDEADRMLDMGFEPQIRKIIEQIRPDRQ 403
           LVLDEAD ML+ GF+ QI  +   + P  Q
Sbjct: 39  LVLDEADEMLNKGFKEQIYDVYRYLPPATQ 68


>SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27)
          Length = 559

 Score = 31.5 bits (68), Expect = 0.65
 Identities = 24/57 (42%), Positives = 34/57 (59%), Gaps = 1/57 (1%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELA-QQIQQVAADFGHTSYV 170
           G+GK+L ++LP++     Q P  RG G I +V  PTRELA Q + +V+   G  S V
Sbjct: 207 GTGKSLVFLLPSV-----QDP-GRGYGTIIVV--PTRELASQMLYEVSRLLGDKSIV 255


>SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057)
          Length = 96

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +3

Query: 3   GSGKTLAYILPAIVHINNQPPIRRGDGPIALVLAPTRELAQQ 128
           G+GKT A++LP +  +  +P   +      LV+ PTRELA Q
Sbjct: 57  GTGKTAAFMLPILERLLYRP--TQSPAIRVLVITPTRELAIQ 96


>SB_19286| Best HMM Match : WD40 (HMM E-Value=1.3)
          Length = 135

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = -2

Query: 344 PTYDQPHQELNMCTAVSWLC-PFPRNQLIYLSSNDY 240
           P Y+Q  +EL  CT  S  C PF +  ++ +SSN++
Sbjct: 99  PAYEQELRELTGCTTHSICCNPFTQRTILVISSNNW 134


>SB_57042| Best HMM Match : WD40 (HMM E-Value=4.9e-09)
          Length = 707

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%)
 Frame = -2

Query: 344 PTYDQPHQELNMCTAVSWLC-PFPRNQLIYLSSNDY 240
           P Y+Q  +EL  CT  S  C PF +  ++ +SSN++
Sbjct: 99  PAYEQELRELTGCTTHSICCNPFTQRTILVISSNNW 134


>SB_50927| Best HMM Match : DEAD (HMM E-Value=3.2e-06)
          Length = 368

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 24/86 (27%), Positives = 44/86 (51%), Gaps = 1/86 (1%)
 Frame = +2

Query: 233 SRNSHCYSGRLIDFLEKGTTNLQRCTYLVLDEA-DRMLDMGFEPQIRKIIEQIRPDRQTL 409
           +R  +C +G L+ + E  +T L   +++V+DE  +R  +  F   + + +   RPD + +
Sbjct: 70  TRLLYCTTGILLRYFESDST-LAGVSHVVVDEVHERTEESDFLMMVLRDLIMERPDLRVI 128

Query: 410 MWSATWPKEVKKLAEDYLGDYIQINI 487
           + SAT      KL  +Y  D   I+I
Sbjct: 129 LMSATLD---SKLFSEYFYDAPVIHI 151


>SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38)
          Length = 475

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD 346
           GR++    + T NL+   + +LDE D+ML+
Sbjct: 176 GRILALTREKTLNLKHAKHFILDECDKMLE 205


>SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 208

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +2

Query: 257 GRLIDFLEKGTTNLQRCTYLVLDEADRMLD 346
           GR++    + T NL+   + +LDE D+ML+
Sbjct: 176 GRILALTREKTLNLKHAKHFILDECDKMLE 205


>SB_36508| Best HMM Match : WD40 (HMM E-Value=0.006)
          Length = 1103

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/74 (20%), Positives = 32/74 (43%)
 Frame = +1

Query: 388 TPRQTDFDVVSYLAQRSEETC*GLLGRLHSDQYRIITTFRNHNILQIVDICQEHEKENKL 567
           T R+T  ++  ++ QR E+TC  +   L      +   ++   +  ++ + QEH+ E   
Sbjct: 65  TRRKTGSELQKFIYQRYEDTCLVIYRELVDGDKHLAIAWQRETVPALIRLQQEHDFEKGQ 124

Query: 568 NVLLQEIGQSQEPG 609
                 +G +   G
Sbjct: 125 GTNFGSVGNTSGAG 138


>SB_37956| Best HMM Match : Helicase_C (HMM E-Value=1.5e-27)
          Length = 331

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 15/47 (31%), Positives = 26/47 (55%)
 Frame = +2

Query: 347 MGFEPQIRKIIEQIRPDRQTLMWSATWPKEVKKLAEDYLGDYIQINI 487
           MGFE  I  I+  +   R+T ++SAT   EV+ L    L + +++ +
Sbjct: 1   MGFEASINTILGYLPKQRRTGLFSATQTDEVEALVRAGLRNPVRVTV 47


>SB_33165| Best HMM Match : ABC_tran (HMM E-Value=0)
          Length = 1310

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 296  LQRCTYLVLDEADRMLDMGFEPQIRKII 379
            LQRC  LVLDEA   +D   + Q++++I
Sbjct: 1219 LQRCKVLVLDEATANVDYRTDRQVQQLI 1246


>SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1075

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 13/28 (46%), Positives = 19/28 (67%)
 Frame = +2

Query: 296  LQRCTYLVLDEADRMLDMGFEPQIRKII 379
            LQRC  LVLDEA   +D   + Q++++I
Sbjct: 984  LQRCKVLVLDEATANVDYRTDRQVQQLI 1011


>SB_24613| Best HMM Match : Ctr (HMM E-Value=0.73)
          Length = 895

 Score = 28.3 bits (60), Expect = 6.1
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 260 RLIDFLEKGTTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIR 391
           R +  LEKG     +     LDEAD+M+D  F    R+++E I+
Sbjct: 372 RQLRHLEKGKETCDQ----KLDEADKMIDAYFREMQRRLMEDIK 411


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,770,012
Number of Sequences: 59808
Number of extensions: 458548
Number of successful extensions: 1177
Number of sequences better than 10.0: 45
Number of HSP's better than 10.0 without gapping: 1078
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1156
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1757375282
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -