SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120007.Seq
         (661 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)          36   0.039
SB_39686| Best HMM Match : ETC_C1_NDUFA4 (HMM E-Value=3.6)             33   0.16 
SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.36 
SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.)              32   0.48 
SB_34278| Best HMM Match : DUF1605 (HMM E-Value=3.6)                   31   0.63 
SB_31| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083)              31   0.63 
SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15)                 31   1.1  
SB_31097| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.1  
SB_31084| Best HMM Match : Collagen (HMM E-Value=9.8)                  30   1.5  
SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.5  
SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45)    30   1.5  
SB_22778| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.9  
SB_58150| Best HMM Match : ig (HMM E-Value=3.7e-24)                    29   2.5  
SB_34920| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.5  
SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11)         29   2.5  
SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0)                 29   2.5  
SB_6936| Best HMM Match : TP2 (HMM E-Value=1.1)                        29   3.4  
SB_45236| Best HMM Match : PRP38 (HMM E-Value=0)                       29   3.4  
SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.4  
SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1)            24   5.3  
SB_44671| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-26)                 28   5.9  
SB_44669| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-26)                 28   5.9  
SB_4451| Best HMM Match : Cornifin (HMM E-Value=0.11)                  28   5.9  
SB_23024| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   5.9  
SB_50721| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  
SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  
SB_32623| Best HMM Match : UCR_hinge (HMM E-Value=5.7)                 28   7.7  
SB_51928| Best HMM Match : HEAT (HMM E-Value=4.9e-22)                  28   7.7  
SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   7.7  
SB_891| Best HMM Match : DUF1098 (HMM E-Value=0.47)                    28   7.7  

>SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10)
          Length = 192

 Score = 35.5 bits (78), Expect = 0.039
 Identities = 23/71 (32%), Positives = 36/71 (50%)
 Frame = +3

Query: 21  FGTVLGIAGSTINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFAY 200
           FGT +G  G T   H     F  +  +Q+A  A + +   GG T+SRA  T A++ +FA 
Sbjct: 36  FGTPIGTEGHT-GRHTADDYFHILQGEQLAFRAGIEFLQPGGSTSSRAAAT-AVELQFAL 93

Query: 201 QEQLAQNLKLM 233
            E    +L ++
Sbjct: 94  YESYYNSLAVV 104


>SB_39686| Best HMM Match : ETC_C1_NDUFA4 (HMM E-Value=3.6)
          Length = 656

 Score = 33.5 bits (73), Expect = 0.16
 Identities = 24/65 (36%), Positives = 30/65 (46%), Gaps = 6/65 (9%)
 Frame = +2

Query: 14  LDFWHGARYSRFDDKQSPEDGRVQGHDGAADGPERERP-VH-----HRGGRDRQPGRHHG 175
           LD  H  R  R  D++S   GR+QG      G  R  P VH     + GGR    G+H  
Sbjct: 328 LDRGHATRQFREKDERS---GRLQGIGAGQGGAARHEPGVHGSDGFYEGGRQHYDGQHGK 384

Query: 176 GDEDR 190
            +EDR
Sbjct: 385 DEEDR 389


>SB_16504| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 252

 Score = 32.3 bits (70), Expect = 0.36
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
 Frame = +2

Query: 35  RYSRFDDKQSPE---DGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVR 196
           RY   +D++  E   D R +   G  D  ER+R    RG RDR+  R    D DR R
Sbjct: 121 RYEDREDRERGERDRDRRRERDRGERDRGERDRGERDRGERDRRRDRDRDRDRDRDR 177


>SB_42841| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1651

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 20/62 (32%), Positives = 31/62 (50%)
 Frame = +2

Query: 245 KSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEA 424
           KS+F  Q +LI  + +Q   + TQ+ DLK    T   S +      A  L+ V Q+L  A
Sbjct: 193 KSTFHNQRNLINTVSSQVTRISTQLADLKTSANTMLASYSFVTRNFAPELTRVDQELSSA 252

Query: 425 DK 430
           ++
Sbjct: 253 NE 254


>SB_34278| Best HMM Match : DUF1605 (HMM E-Value=3.6)
          Length = 243

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 24/79 (30%), Positives = 30/79 (37%)
 Frame = +2

Query: 35  RYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTS 214
           R  R  D+    D R +  D   D  ER+R    R   DR   R    D DR R     S
Sbjct: 80  RDRRDRDRDRDRDRRDRDRDKERDRRERDRRDRDRRRSDRDSDRDRRRDRDRGRSSRDAS 139

Query: 215 PKFEVDAGEYKSSFSKQTS 271
           P  E   G+   S   ++S
Sbjct: 140 PDREERKGDKDKSRRSRSS 158


>SB_31| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083)
          Length = 902

 Score = 31.5 bits (68), Expect = 0.63
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = +2

Query: 86  GHDGAADGPERERPVHHRGGRDRQPGRHHGG 178
           G    A  P  + P  H  GRD  P +HH G
Sbjct: 7   GKPAQASSPRDQSPSKHHPGRDTSPSKHHPG 37


>SB_20899| Best HMM Match : RRM_1 (HMM E-Value=2.3e-15)
          Length = 876

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 18/47 (38%), Positives = 20/47 (42%)
 Frame = +2

Query: 26  HGARYSRFDDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGR 166
           HG    R  D+ SP   R +G  G  D P R    H R GR   P R
Sbjct: 159 HGRGRGRGRDRLSPPPHRDRGRPGYDDRPPRFDHPHERYGRPLSPPR 205


>SB_31097| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 883

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = -3

Query: 494 CRCLLGFDLVPATPWPVPGRG--PCQPRRDLGARLRGP 387
           CR   G  LV AT  P P R   P QP +DL A L GP
Sbjct: 707 CRACHGCQLVGATNPPEPLRHTVPTQPWKDLAADLMGP 744


>SB_31084| Best HMM Match : Collagen (HMM E-Value=9.8)
          Length = 80

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 20/51 (39%), Positives = 22/51 (43%)
 Frame = +2

Query: 95  GAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYK 247
           G  DG ERE     R GR+   GR   GDE    + G      E D GE K
Sbjct: 20  GEEDGDEREMGTRGRWGREGNGGREADGDER--DMGGERKMGGEGDGGEIK 68


>SB_48451| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2851

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 26/115 (22%), Positives = 47/115 (40%), Gaps = 4/115 (3%)
 Frame = +2

Query: 59   QSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPG----TTSPKFE 226
            +S  DGR  G  G  D   R  P        ++ G H   ++ +V   G    TT PK  
Sbjct: 1431 RSTSDGRHAGQKGPRDDSSRSGPRRDNQRNTQKKGDHFLAEKQQVTADGSKASTTEPKGA 1490

Query: 227  VDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKA 391
            + A +   +    TS +    N++ +   +   +  +   A+++S + D  + KA
Sbjct: 1491 LPAAK---TGDASTSKLAGGQNRQEMKGNEFIAVDSIGSDAAKASKRPDQAVKKA 1542


>SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45)
          Length = 4160

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 1/51 (1%)
 Frame = +2

Query: 305  VETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADK-DRDLEPAK 454
            VET++++ ++ + T   +  KS+ E+AKA   +    DE  + + +L  AK
Sbjct: 1752 VETELQNARKRLATLETTERKSEEELAKANHEIQVSKDEISRLETELNAAK 1802


>SB_22778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 620

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 19/79 (24%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
 Frame = +2

Query: 233 AGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKS-DAEIAKALSVVHQ 409
           A EY+   +K  S +  +  +   V+ ++KDL  ++    Q +A++   E      V+  
Sbjct: 279 AEEYRQRATKTRSELMELEVERDAVQQEIKDLSTMLQRQKQDTAEAVQVERKNERKVMEL 338

Query: 410 DLDEADKDRDLEPAKVSLE 466
            L+     R++E +K  LE
Sbjct: 339 TLERDKLLREMESSKTRLE 357


>SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 2142

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 26/109 (23%), Positives = 43/109 (39%), Gaps = 8/109 (7%)
 Frame = +2

Query: 26   HGARYSRFDDKQSPEDGRVQGHDGAADGPERERP--VHHRGGRDRQPGRHHGGDEDRVRL 199
            HG     F    SP +G   GH    DG E ++P  +  +  R R+        E + + 
Sbjct: 859  HGNSDVSFSGHSSPREGNSSGHSSPRDGMEVDKPATLKRQSSRQRETCSKVKKLEAKSKT 918

Query: 200  P----GTTSPKFEVDAGEYKSSFSKQTSLIEHM--HNQEHLVETQMKDL 328
            P    G    +F+V    +K    K     E +  + +  ++ET+  DL
Sbjct: 919  PDCPEGYCWSQFQVGLCSFKFCRLKHFPTTEELQKYKETRVLETESADL 967


>SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1572

 Score = 29.9 bits (64), Expect = 1.9
 Identities = 29/137 (21%), Positives = 48/137 (35%), Gaps = 1/137 (0%)
 Frame = +2

Query: 59   QSPEDGRVQGHDGAADGPERERPVHH-RGGRDRQPGRHHGGDEDRVRLPGTTSPKFEVDA 235
            ++P+D RV G D  A      R     R G  R   +    +ED       T  +     
Sbjct: 1404 ETPDD-RVDGKDNIASKQNSHRTTTRGRAGWGRPVAQAQSTEEDIAGSDPETPLRRARAT 1462

Query: 236  GEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDL 415
               K   + Q S+++H        ET     KR+  +A  + AK   +       V   L
Sbjct: 1463 RNQKQRDASQDSILDHAEEIHERPETTKLRQKRMHTSAEPADAKRSTKRTSRQGPVESSL 1522

Query: 416  DEADKDRDLEPAKVSLE 466
             E+ +    +  +  +E
Sbjct: 1523 GESSELEGTDTIEADVE 1539


>SB_58150| Best HMM Match : ig (HMM E-Value=3.7e-24)
          Length = 456

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 12/38 (31%), Positives = 18/38 (47%)
 Frame = -3

Query: 542 LTLPRMLPNIIGSTLLCRCLLGFDLVPATPWPVPGRGP 429
           +T+   L  ++ +T+  RC    D  P T W  PG  P
Sbjct: 247 MTIGTNLTTLVNTTITIRCQASGDPAPDTAWQRPGNKP 284


>SB_34920| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 366

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 24/105 (22%), Positives = 44/105 (41%)
 Frame = +2

Query: 50  DDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPKFEV 229
           DD+ +P+  R + H G+ +  E+ R      G+D +             + G  S    +
Sbjct: 3   DDEDAPQAKRQRIHFGSLEEVEKNRLASQTTGKDGKEMDEVDRIISNAIMEGIQSGNINI 62

Query: 230 DAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSA 364
             GEY    S+ T+   H   QE L + + +   R+I   + ++A
Sbjct: 63  SEGEY-LELSEDTTSERH---QELLEQFERRKKARMITVPTDNAA 103


>SB_1305| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.8e-11)
          Length = 1491

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 15/63 (23%), Positives = 35/63 (55%)
 Frame = +2

Query: 221 FEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKSDAEIAKALSV 400
           +E+   ++KSSFS+Q S +E     E   +T++++L   +   +++  +   E+ +AL +
Sbjct: 318 YEIQILDFKSSFSEQISTLEAALQHEQEQKTRLEELNISLRGDNEAILREVDEMKRALLL 377

Query: 401 VHQ 409
             +
Sbjct: 378 AQE 380


>SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0)
          Length = 1997

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 20/83 (24%), Positives = 40/83 (48%), Gaps = 10/83 (12%)
 Frame = +2

Query: 218  KFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIV-------TASQSSAKSD- 373
            KFE D  E + +        + +      ++ Q+KDL+ ++         A +S+A+++ 
Sbjct: 1653 KFETDCNEMEINLENSMKANQELQKTTKKLQQQVKDLQLMVEEEQRGRDDARESAARAER 1712

Query: 374  --AEIAKALSVVHQDLDEADKDR 436
              AE+A  L  +   L++AD+ R
Sbjct: 1713 RSAELAAELEDLRNQLEQADRAR 1735


>SB_6936| Best HMM Match : TP2 (HMM E-Value=1.1)
          Length = 256

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +2

Query: 62  SPEDGRVQGHDGAADG--PERERPVHHRGGRDRQPGRHHGGDEDRVRLPGTTSPK 220
           SP+  + +    ++DG  P+R+RP  HR  R R   +    D+    LP + +PK
Sbjct: 136 SPDSHKSRSESPSSDGESPDRQRPSPHRRSRPRN-RKDRQLDKKTKTLPNSYAPK 189


>SB_45236| Best HMM Match : PRP38 (HMM E-Value=0)
          Length = 381

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 19/53 (35%), Positives = 23/53 (43%), Gaps = 1/53 (1%)
 Frame = +2

Query: 41  SRFDDKQSPEDGRVQGHDGAADGP-ERERPVHHRGGRDRQPGRHHGGDEDRVR 196
           SR  D  S  + R +  D   D P + ER  +    RDR   R H  D DR R
Sbjct: 259 SRSRDHSSRRNSRDKSRDPDRDRPRDSERDRYRDIERDRHRDRRHSRDRDRKR 311


>SB_17584| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 158

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/48 (33%), Positives = 28/48 (58%)
 Frame = +3

Query: 90  MMEQQMARSASVLYTIAGGGTASRADITEAMKTEFAYQEQLAQNLKLM 233
           M E ++A  +S+ +   GG T+SRA  T A++ +FA  E    +L ++
Sbjct: 52  MSEAEIAEISSIEFLQPGGSTSSRAAAT-AVELQFALYESYYNSLAVV 98


>SB_49054| Best HMM Match : Chordopox_A30L (HMM E-Value=4.1)
          Length = 432

 Score = 24.2 bits (50), Expect(2) = 5.3
 Identities = 13/49 (26%), Positives = 22/49 (44%)
 Frame = +2

Query: 50  DDKQSPEDGRVQGHDGAADGPERERPVHHRGGRDRQPGRHHGGDEDRVR 196
           DD +   D R +   G+++   R       G +DR   R   GD++R +
Sbjct: 40  DDSRRRRDDRGEIASGSSEPDPRREKRRREGDKDRVKDRER-GDKERTK 87



 Score = 22.6 bits (46), Expect(2) = 5.3
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +2

Query: 311 TQMKDLKRLIVTASQSSAKSDAEIAKALSVVHQDLDEADKDR 436
           T+ KD  R   T    + + D E  K  S  +QD +  D+DR
Sbjct: 104 TRDKDRGRHEKTDKGRNGEGDREKRKERSDRNQDYERKDRDR 145


>SB_44671| Best HMM Match : 7tm_1 (HMM E-Value=1.7e-26)
          Length = 298

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 11/21 (52%), Positives = 17/21 (80%)
 Frame = -3

Query: 542 LTLPRMLPNIIGSTLLCRCLL 480
           LTL  +LPN+IG+TL+C  ++
Sbjct: 23  LTLVLVLPNLIGNTLVCLTII 43


>SB_44669| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-26)
          Length = 308

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 11/17 (64%), Positives = 15/17 (88%)
 Frame = -3

Query: 542 LTLPRMLPNIIGSTLLC 492
           LTL  +LPN+IG+TL+C
Sbjct: 23  LTLALVLPNLIGNTLVC 39


>SB_4451| Best HMM Match : Cornifin (HMM E-Value=0.11)
          Length = 1384

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 5/43 (11%)
 Frame = +2

Query: 77  RVQGHDGAADGPERERPVHHRGGRDRQP-----GRHHGGDEDR 190
           R++ H G+   P       H GG D +P      RHHGG + +
Sbjct: 604 RIKHHGGSHSKPYCGNRFKHHGGSDSKPYCGNRFRHHGGSDSK 646


>SB_23024| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 593

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 13/36 (36%), Positives = 17/36 (47%)
 Frame = +3

Query: 180 MKTEFAYQEQLAQNLKLMQENINHLSASKLPLSNTC 287
           M  E  Y E L   LK +Q N  H + S   ++N C
Sbjct: 95  MDAEXIYSEALMDELKKLQVNRPHYTTSNQDMNNDC 130


>SB_50721| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1057

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 17/54 (31%), Positives = 24/54 (44%)
 Frame = +2

Query: 209 TSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLKRLIVTASQSSAKS 370
           T PKF  D G   S   +  +   H      L ET+  DL R I T+ + + K+
Sbjct: 243 TYPKFGYDDGFDHSPRKRSLNKGNHTEVSRQLKETEDSDLTRAIQTSLEDTKKA 296


>SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 561

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +2

Query: 113 ERERPVHHRGGRD-RQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMH 289
           E ER  H R  RD  +  + +   +D + +   TSP+  + + +  S+ S +TSL++ + 
Sbjct: 99  EAERLNHQRVLRDYSRLEQRYQNLQDELEIV-QTSPQKPLRSLDSVSTASSETSLVDALE 157

Query: 290 NQEHLVETQMKDLKRLIVTASQ 355
            +    E +  D  R I+T SQ
Sbjct: 158 KELREQEAEEPDEVRSIITKSQ 179


>SB_32623| Best HMM Match : UCR_hinge (HMM E-Value=5.7)
          Length = 124

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 18/73 (24%), Positives = 31/73 (42%)
 Frame = +2

Query: 152 RQPGRHHGGDEDRVRLPGTTSPKFEVDAGEYKSSFSKQTSLIEHMHNQEHLVETQMKDLK 331
           RQPGRH         + G  +  ++    +       +  L+E + NQ   +E  M++ K
Sbjct: 18  RQPGRHFSAG---YHVFGHVTSSYDAKYSQMTYGDHYRKKLVEDIENQREHLEQIMREQK 74

Query: 332 RLIVTASQSSAKS 370
           RL      S+ K+
Sbjct: 75  RLAEAKRVSALKA 87


>SB_51928| Best HMM Match : HEAT (HMM E-Value=4.9e-22)
          Length = 1115

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 21/66 (31%), Positives = 27/66 (40%), Gaps = 4/66 (6%)
 Frame = +2

Query: 32  ARYSRFDDKQSPEDGRVQGHD--GAADGPERERPVHHRGGRDRQPG--RHHGGDEDRVRL 199
           AR +R+D+    E G   GH   G A+ P  +R      G    PG  R    DE     
Sbjct: 157 ARRNRWDETPKTERGETPGHSTPGWAETPRTDRMGAETPGATPTPGSKRRSRWDETPASQ 216

Query: 200 PGTTSP 217
            G T+P
Sbjct: 217 MGGTTP 222


>SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 193

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 16/62 (25%), Positives = 33/62 (53%)
 Frame = +3

Query: 48  STINNHLKMAEFRDMMEQQMARSASVLYTIAGGGTASRADITEAMKTEFAYQEQLAQNLK 227
           +  +++L   + R ++E    +  S+ +   GG T+SRA  T A++ +FA  E    +L 
Sbjct: 45  NAFSSNLPERDVRQVLEDGDLKRRSIEFLQPGGSTSSRAAAT-AVELQFALYESYYNSLA 103

Query: 228 LM 233
           ++
Sbjct: 104 VV 105


>SB_891| Best HMM Match : DUF1098 (HMM E-Value=0.47)
          Length = 715

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 4/101 (3%)
 Frame = +3

Query: 6   IVASIFGTVLGIAGSTINNHLKMAEFRDMMEQQMARSA--SVLYTIAGGGTA--SRADIT 173
           ++  +   VLG   +    +L + +F     QQ A +    +  +IA G  A  S+ D T
Sbjct: 350 LITMLPANVLGAGSTGQPGNLGIQQFNATGSQQDATAPLRGLGKSIAQGQVANPSQKDAT 409

Query: 174 EAMKTEFAYQEQLAQNLKLMQENINHLSASKLPLSNTCTIR 296
            +M+     Q +L  N   +QEN  +  A+  PLSN   ++
Sbjct: 410 -SMQLPGVPQMKLFDNSSALQENATNSQAATSPLSNELQVQ 449


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,986,035
Number of Sequences: 59808
Number of extensions: 428848
Number of successful extensions: 1558
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 1354
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1543
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1693527500
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -