SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120006.Seq
         (617 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_4003| Best HMM Match : Ribosomal_L5_C (HMM E-Value=0)              152   3e-37
SB_20626| Best HMM Match : DSL (HMM E-Value=2.2e-19)                   33   0.14 
SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.)              30   1.3  
SB_6002| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-26)                  29   2.3  
SB_56087| Best HMM Match : Extensin_2 (HMM E-Value=0.29)               29   3.0  
SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.0  
SB_42606| Best HMM Match : Ank (HMM E-Value=3.4e-08)                   28   7.0  
SB_52577| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.2  
SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   9.2  
SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88)               27   9.2  
SB_7224| Best HMM Match : TIL (HMM E-Value=8.2)                        27   9.2  

>SB_4003| Best HMM Match : Ribosomal_L5_C (HMM E-Value=0)
          Length = 260

 Score =  152 bits (368), Expect = 3e-37
 Identities = 69/91 (75%), Positives = 80/91 (87%)
 Frame = +1

Query: 235 CPLYSPRAKAEEILERGLKVREYELRRDNFSATGNFGFGIQEHIDLGIKYDPSIGIYGLD 414
           C +  P  KAEEILE+GLKV+EYEL +  FSATGNFGFGIQEHIDLGIKYDPSIGIYG+D
Sbjct: 64  CTVRGP--KAEEILEKGLKVKEYELVKGCFSATGNFGFGIQEHIDLGIKYDPSIGIYGMD 121

Query: 415 FYVVLGRPGFNVAHRRRKTGKVGFPHRLTKE 507
           F+VVLGRPGFN++ R+ K G+VGFPHRLTK+
Sbjct: 122 FFVVLGRPGFNISKRKHKQGRVGFPHRLTKD 152



 Score =  127 bits (306), Expect = 8e-30
 Identities = 62/74 (83%), Positives = 66/74 (89%)
 Frame = +2

Query: 56  NVMRNLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIA 235
           N M+ L IRKL LNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKI+
Sbjct: 2   NPMKELRIRKLVLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIS 61

Query: 236 VHCTVRELKQKKSL 277
           VHCTVR  K ++ L
Sbjct: 62  VHCTVRGPKAEEIL 75


>SB_20626| Best HMM Match : DSL (HMM E-Value=2.2e-19)
          Length = 323

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 3/58 (5%)
 Frame = +2

Query: 134 AAKVLEQLTGQQPVFSKARYTVRS---FGIRRNEKIAVHCTVRELKQKKSLRGV*KSE 298
           AA ++E++    P FS  RY++        +++ K+ V   VRE    KS+RG  K+E
Sbjct: 262 AATLVEEVASSPPRFSLMRYSLYPDLVLNFKKSRKLTVQSLVRETLTMKSMRGPTKTE 319


>SB_57821| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 941

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +3

Query: 117 VTG*LVPPRCWSNSQDNSLYFP 182
           VT  LVPP  W+ SQD  +Y+P
Sbjct: 742 VTPPLVPPMPWTGSQDAGMYYP 763


>SB_6002| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-26)
          Length = 376

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -3

Query: 306 FIFSDFQTPLKDFFCFS-SRTVQWTAIFSLRR 214
           F   +F+  +K  FC   S+ +QWT IFS RR
Sbjct: 331 FTNKNFKLAVKRLFCGGVSKNMQWTGIFSSRR 362


>SB_56087| Best HMM Match : Extensin_2 (HMM E-Value=0.29)
          Length = 403

 Score = 29.1 bits (62), Expect = 3.0
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%)
 Frame = -1

Query: 350 PKPKLPVAEKLSRRNSYSL-TFKPLSRISSALALGLYNGQQSFHY 219
           P P++P +  L    +  L T+KPL RIS++L+L       S+ Y
Sbjct: 303 PLPRIPTSLSLVSLQAPPLYTYKPLPRISTSLSLVSLQASPSYPY 347


>SB_57888| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 565

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = +2

Query: 470 QEKWDFPTASQRKCYEVVPTEI*WYH 547
           Q  W+ PT +Q   Y    T+  WYH
Sbjct: 233 QANWNHPTKTQANWYHPTKTQANWYH 258


>SB_42606| Best HMM Match : Ank (HMM E-Value=3.4e-08)
          Length = 551

 Score = 27.9 bits (59), Expect = 7.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 310 RRDNFSATGNFGFGIQEHIDLGIKYD 387
           ++ ++SATG+F   ++EHI  G + D
Sbjct: 306 KKSHYSATGSFDGSVEEHISEGAQED 331


>SB_52577| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 260

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 17/48 (35%), Positives = 20/48 (41%)
 Frame = -3

Query: 384 VLDTQVNVFLNTEAKITRGGEVVTPQFIFSDFQTPLKDFFCFSSRTVQ 241
           V D QVN FLN         E   P+  +    TP KD  C  S T +
Sbjct: 21  VTDKQVNDFLNVCIDSKHHKEKPGPEVDYFHHCTPWKDHACCKSNTTK 68


>SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 318

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 13/26 (50%), Positives = 15/26 (57%)
 Frame = +2

Query: 116 GDRLTRAAKVLEQLTGQQPVFSKARY 193
           G R TR A   +QLT  + VFSK  Y
Sbjct: 66  GSRRTRTAFTHQQLTALEKVFSKTHY 91


>SB_10020| Best HMM Match : Extensin_2 (HMM E-Value=0.88)
          Length = 379

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)
 Frame = -1

Query: 350 PKPKLPVAEKL-SRRNSYSLTFKPLSRISSALAL 252
           P P++P +  L S + S S  +KP+SRI ++L+L
Sbjct: 149 PLPRIPTSPSLVSLQVSPSYPYKPVSRIPTSLSL 182


>SB_7224| Best HMM Match : TIL (HMM E-Value=8.2)
          Length = 147

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 18/69 (26%), Positives = 25/69 (36%)
 Frame = -1

Query: 464 RLLCATLKPGRXXXXXXXXXXXXIEGSYLIPKSMCS*IPKPKLPVAEKLSRRNSYSLTFK 285
           R  C T+KP                    IP   C    K K P+++ L     YS+ F+
Sbjct: 77  RCYCLTVKPCGSKISADPRICPENVADRRIPPLECDIQAKIKTPISKTLLHVRLYSIVFR 136

Query: 284 PLSRISSAL 258
           P     S+L
Sbjct: 137 PTKTQKSSL 145


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,016,197
Number of Sequences: 59808
Number of extensions: 394678
Number of successful extensions: 1059
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 974
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1059
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1524174750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -