SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120005.Seq
         (647 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_50131| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   4.3  
SB_4638| Best HMM Match : DUF1283 (HMM E-Value=0.46)                   29   4.3  
SB_1395| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   4.3  

>SB_50131| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 52

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -2

Query: 382 LVALGIKIRLIPLSLFPTKCLAIVILN*LSSSSKMGKTIFDILN 251
           L  +G+ + LIPL++F TK    + +  +    K  K I ++LN
Sbjct: 6   LAGIGVMLLLIPLNMFVTKLSRKLQVKTMEEKDKRMKIIGEVLN 49


>SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1308

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -2

Query: 382 LVALGIKIRLIPLSLFPTKCLAIVILN*LSSSSKMGKTIFDILN 251
           L  +G+ + LIPL++F TK    + +  +    K  K I ++LN
Sbjct: 6   LAGIGVMLLLIPLNMFVTKLSRKLQVKTMEEKDKRMKIIGEVLN 49


>SB_4638| Best HMM Match : DUF1283 (HMM E-Value=0.46)
          Length = 986

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 20/71 (28%), Positives = 31/71 (43%)
 Frame = +1

Query: 94   MPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQKWF 273
            +PV  A       + +   I++F  C+T        A+ D   ++   HL+ RL   +W 
Sbjct: 880  IPVEKARSSSVAQKAVILVIINF-ICVTTIDTYQQPAHSDGKKYL--PHLLIRLAAMRWC 936

Query: 274  CPFSTKTTINS 306
               STKT  NS
Sbjct: 937  RKNSTKTCRNS 947


>SB_1395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 52

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -2

Query: 382 LVALGIKIRLIPLSLFPTKCLAIVILN*LSSSSKMGKTIFDILN 251
           L  +G+ + LIPL++F TK    + +  +    K  K I ++LN
Sbjct: 6   LAGIGVMLLLIPLNMFVTKLSRKLQVKTMEEKDKRMKIIGEVLN 49


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,888,181
Number of Sequences: 59808
Number of extensions: 389426
Number of successful extensions: 1067
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 990
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1062
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1645141000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -