SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120004.Seq
         (720 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.)               31   0.71 
SB_25472| Best HMM Match : No HMM Matches (HMM E-Value=.)              31   1.2  
SB_20162| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   2.9  
SB_50131| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.0  
SB_4638| Best HMM Match : DUF1283 (HMM E-Value=0.46)                   29   5.0  
SB_1395| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.0  
SB_15990| Best HMM Match : zf-CCCH (HMM E-Value=4.1)                   28   6.6  
SB_28889| Best HMM Match : ANF_receptor (HMM E-Value=1.1e-34)          28   8.8  

>SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 3133

 Score = 31.5 bits (68), Expect = 0.71
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +3

Query: 387  QEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYTEVSQRHAT 521
            Q++ +  ++   + +IF L YNN+ AV+ +C  L Y   +  H T
Sbjct: 1405 QDILSEVALYLPKYVIFELYYNNKRAVSGLCHWLSYQPGAVHHGT 1449


>SB_25472| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1191

 Score = 30.7 bits (66), Expect = 1.2
 Identities = 14/45 (31%), Positives = 25/45 (55%)
 Frame = +3

Query: 387 QEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYTEVSQRHAT 521
           Q++ +  ++   + +IF L YNN+ AV+ +C  L Y   +  H T
Sbjct: 751 QDILSEVALYLPKYVIFELNYNNKRAVSGLCHWLSYQPGAVHHGT 795


>SB_20162| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 842

 Score = 29.5 bits (63), Expect = 2.9
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 468 NVICDNLKYTEVSQRHATRYTQRLRNYKKHSRH 566
           NV+C  LK +E  Q+   +  ++L+  +KH RH
Sbjct: 323 NVVCLQLKNSEEIQKQNAQQKEKLQEAQKHIRH 355


>SB_50131| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 52

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -3

Query: 382 LVALGIKIRLIPLSLFPTKCLAIVILN*LSSSSKMGKTIFDILN 251
           L  +G+ + LIPL++F TK    + +  +    K  K I ++LN
Sbjct: 6   LAGIGVMLLLIPLNMFVTKLSRKLQVKTMEEKDKRMKIIGEVLN 49


>SB_36385| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1308

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -3

Query: 382 LVALGIKIRLIPLSLFPTKCLAIVILN*LSSSSKMGKTIFDILN 251
           L  +G+ + LIPL++F TK    + +  +    K  K I ++LN
Sbjct: 6   LAGIGVMLLLIPLNMFVTKLSRKLQVKTMEEKDKRMKIIGEVLN 49


>SB_4638| Best HMM Match : DUF1283 (HMM E-Value=0.46)
          Length = 986

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 20/71 (28%), Positives = 31/71 (43%)
 Frame = +1

Query: 94   MPVGMAPRQMRVNRCIFASIVSFDACITYKSPCSPDAYHDDGWFICNSHLIKRLKCQKWF 273
            +PV  A       + +   I++F  C+T        A+ D   ++   HL+ RL   +W 
Sbjct: 880  IPVEKARSSSVAQKAVILVIINF-ICVTTIDTYQQPAHSDGKKYL--PHLLIRLAAMRWC 936

Query: 274  CPFSTKTTINS 306
               STKT  NS
Sbjct: 937  RKNSTKTCRNS 947


>SB_1395| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 52

 Score = 28.7 bits (61), Expect = 5.0
 Identities = 14/44 (31%), Positives = 24/44 (54%)
 Frame = -3

Query: 382 LVALGIKIRLIPLSLFPTKCLAIVILN*LSSSSKMGKTIFDILN 251
           L  +G+ + LIPL++F TK    + +  +    K  K I ++LN
Sbjct: 6   LAGIGVMLLLIPLNMFVTKLSRKLQVKTMEEKDKRMKIIGEVLN 49


>SB_15990| Best HMM Match : zf-CCCH (HMM E-Value=4.1)
          Length = 236

 Score = 28.3 bits (60), Expect = 6.6
 Identities = 14/50 (28%), Positives = 20/50 (40%)
 Frame = +3

Query: 438 HLIYNNEEAVNVICDNLKYTEVSQRHATRYTQRLRNYKKHSRHHKPEHVL 587
           H ++      +  C  L  T     HATR+T  +  Y  H+  H   H L
Sbjct: 129 HTLHVTGNTSHATCHTLHVTRYMS-HATRHTLHVTRYTSHATCHTLRHTL 177


>SB_28889| Best HMM Match : ANF_receptor (HMM E-Value=1.1e-34)
          Length = 933

 Score = 27.9 bits (59), Expect = 8.8
 Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 5/90 (5%)
 Frame = +3

Query: 285 DEDDNQFKMTIAR---HLVGNKERGIKRILIPS-ATNYQEVFNLNSMMQ-AEQLIFHLIY 449
           DEDD+     I R     +  K R    +L  S   NY ++  +N   + A ++I    Y
Sbjct: 371 DEDDSDDINNITRACIRFIYRKRRYENDLLSRSWIINYDDIQPVNMDTRFASKVIKDFSY 430

Query: 450 NNEEAVNVICDNLKYTEVSQRHATRYTQRL 539
           +N+   + I D L+Y   S R   RY   L
Sbjct: 431 DNQSRCSRITDMLQYQRSSVRDVGRYKGEL 460


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,829,522
Number of Sequences: 59808
Number of extensions: 439044
Number of successful extensions: 1077
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 969
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1073
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1913853903
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -