SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120003.Seq
         (731 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30)                   33   0.32 
SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)                     31   1.3  
SB_8042| Best HMM Match : DUF803 (HMM E-Value=0)                       29   3.9  
SB_39662| Best HMM Match : BIR (HMM E-Value=1.2e-19)                   29   3.9  
SB_1636| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.1  
SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09)                28   6.8  
SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)                 28   9.0  
SB_7260| Best HMM Match : PAN (HMM E-Value=0.00036)                    28   9.0  

>SB_16819| Best HMM Match : BIR (HMM E-Value=7.5e-30)
          Length = 514

 Score = 32.7 bits (71), Expect = 0.32
 Identities = 14/40 (35%), Positives = 18/40 (45%)
 Frame = +1

Query: 541 GFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           GF Y    D V C  C   ++NW  D+     H   SP+C
Sbjct: 156 GFYYLGDQDSVKCYKCGVALRNWEPDDLPWVEHEKWSPHC 195


>SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0)
          Length = 4303

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%)
 Frame = +1

Query: 502 HCNTAFINSLIVNGFKYNQVDDHVV-CEYCEAEIKNWSEDECIEYAHVTLSPYCAYANKI 678
           HCN  F  S +++  K    D+ +V C YC+     +   E IE  H      CA  N++
Sbjct: 503 HCNGRFPASDLLSHVKMFHRDEKLVKCNYCKKIFTKYGMKEHIEQVHNKPGFKCAQCNQM 562


>SB_8042| Best HMM Match : DUF803 (HMM E-Value=0)
          Length = 603

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 14/30 (46%), Positives = 19/30 (63%)
 Frame = -3

Query: 633 IFNTLVFGPIFYFCFTILAHNVIVDLIVFK 544
           IFNT +  PI+Y  FT+L   +I   I+FK
Sbjct: 485 IFNTSLVTPIYYVMFTLL--TIIASAILFK 512


>SB_39662| Best HMM Match : BIR (HMM E-Value=1.2e-19)
          Length = 314

 Score = 29.1 bits (62), Expect = 3.9
 Identities = 15/51 (29%), Positives = 23/51 (45%)
 Frame = +1

Query: 508 NTAFINSLIVNGFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 660
           ++A +  L   GF +   DD V C  C+  +K W  D+    +H    P C
Sbjct: 149 SSANVFELARAGFVFTGRDDVVECFKCKGTLKQWKVDDRPIESHREFYPDC 199


>SB_1636| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 129

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = -3

Query: 711 GNVVAKRFVLSNLVGIRAIRRQGYVCIF-NTLVFGPIFYFCFTI 583
           G++V  ++V+   + +RA+R QG++ I  +TL   P +Y  + I
Sbjct: 65  GHLVIGQYVIKGTLLLRAVRYQGHLVITGSTLSIAPCYYGQYVI 108


>SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09)
          Length = 2059

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +1

Query: 295 TKTKLGHINVSLNQNDPNVLILTVTL 372
           TKT L  +     +NDPNVL +TV L
Sbjct: 760 TKTALSTVQCCSLENDPNVLAITVIL 785


>SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0)
          Length = 2629

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
 Frame = +2

Query: 104 QNYTVLKRLSNG---FIDKSVDVGSISELQKFNFKINRLTSYISNIFEY 241
           QN +V+KRL +G    +DK++ +G      +    +  L  +++ IFEY
Sbjct: 178 QNLSVIKRLGSGNFGHVDKAMAIGIPGFPGQVTVAVKTLKDHLAIIFEY 226


>SB_7260| Best HMM Match : PAN (HMM E-Value=0.00036)
          Length = 161

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 20/72 (27%), Positives = 30/72 (41%)
 Frame = +2

Query: 2   SVVSMCVDNAFAYTTDDLLKNISFSHSKCAPFKLQNYTVLKRLSNGFIDKSVDVGSISEL 181
           SV+   V  A AY+ DD +KN++    K     L  +          +D S       E 
Sbjct: 17  SVLLSAVQLAHAYSLDDCIKNVNRQFIKTQGKYLHGFKFDTIFVKKPLDCSFKCMDQIEC 76

Query: 182 QKFNFKINRLTS 217
           Q FN+++   TS
Sbjct: 77  QSFNYQLESSTS 88


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,533,523
Number of Sequences: 59808
Number of extensions: 396938
Number of successful extensions: 1150
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1020
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1150
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1962001171
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -