SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120002.Seq
         (725 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_57784| Best HMM Match : No HMM Matches (HMM E-Value=.)              48   6e-06
SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.)               32   0.54 
SB_22455| Best HMM Match : Pept_tRNA_hydro (HMM E-Value=2.3)           29   3.8  
SB_56633| Best HMM Match : CbiX (HMM E-Value=4.6)                      29   5.1  
SB_48778| Best HMM Match : No HMM Matches (HMM E-Value=.)              29   5.1  
SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.)               29   5.1  

>SB_57784| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 593

 Score = 48.4 bits (110), Expect = 6e-06
 Identities = 28/67 (41%), Positives = 36/67 (53%)
 Frame = +3

Query: 303 GPYEVKAGGSTTIKFKNVFDSSRMFKIYVDREEFYVKTMFETIKPKKDLRISVYLNDKPA 482
           GPY +KAG +T I FKNVF ++  F   VD   F VK   ETI+ KK   + V       
Sbjct: 500 GPYSIKAGSTTNIPFKNVFSNTTQFMFCVDSPCFNVKAT-ETIRAKKTHNVIVGFEGN-- 556

Query: 483 QGWTEVP 503
           QG ++ P
Sbjct: 557 QGGSKAP 563


>SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 397

 Score = 31.9 bits (69), Expect = 0.54
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = -2

Query: 715 KMALRKLILLWSTSEETVRVLAFLCILRITR 623
           +  L +L+ +W T +E VRV+AFL I ++ R
Sbjct: 126 RKGLERLVRMWGTGDEHVRVVAFLGINKLLR 156


>SB_22455| Best HMM Match : Pept_tRNA_hydro (HMM E-Value=2.3)
          Length = 420

 Score = 29.1 bits (62), Expect = 3.8
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = -1

Query: 509 TSRYFCPALCGLVVQINRYSQVLLWFYSFKHSFNVKLLP 393
           T  +  PALC L+  I   S V+LWF  ++HS   K+LP
Sbjct: 150 TKSWQIPALCVLLAAI---SGVILWFLVWRHS--AKILP 183


>SB_56633| Best HMM Match : CbiX (HMM E-Value=4.6)
          Length = 344

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 1   LKCLPGKEKNLEFTTSFGTCIPLRLRIQNKT 93
           L  LP  E +LEFT S   C PL  +I+ +T
Sbjct: 11  LLALPADEASLEFTASTKVCGPLAEQIKQQT 41


>SB_48778| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1165

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +2

Query: 518 IETHEPAEPKVHWTYFLQGKQ*IQNNWI*KKC 613
           +    P EPKVHW+    GKQ +   W+  KC
Sbjct: 386 VNVDAPVEPKVHWSCEKIGKQRV---WMINKC 414


>SB_5593| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 964

 Score = 28.7 bits (61), Expect = 5.1
 Identities = 14/31 (45%), Positives = 18/31 (58%)
 Frame = +1

Query: 1   LKCLPGKEKNLEFTTSFGTCIPLRLRIQNKT 93
           L  LP  E +LEFT S   C PL  +I+ +T
Sbjct: 728 LLALPADEASLEFTASTKVCGPLAEQIKQQT 758


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,192,285
Number of Sequences: 59808
Number of extensions: 417762
Number of successful extensions: 1070
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1038
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1070
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1937927537
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -