SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20079
         (698 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U02588-1|AAA18901.1|  110|Anopheles gambiae translation initiati...    96   1e-21
AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr...    25   1.7  
AJ441131-5|CAD29634.1|  574|Anopheles gambiae putative Na+ chann...    24   4.0  
AY331408-1|AAQ97589.1|  100|Anopheles gambiae agCP14332 protein.       23   7.0  
AY331407-1|AAQ97588.1|  101|Anopheles gambiae agCP14332 protein.       23   7.0  
AY331406-1|AAQ97587.1|   96|Anopheles gambiae agCP14332 protein.       23   7.0  
AY331405-1|AAQ97586.1|   96|Anopheles gambiae agCP14332 protein.       23   7.0  
AY331404-1|AAQ97585.1|  100|Anopheles gambiae agCP14332 protein.       23   7.0  
DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.            23   9.2  
DQ139954-1|ABA29475.1|  451|Anopheles gambiae protein O-fucosylt...    23   9.2  

>U02588-1|AAA18901.1|  110|Anopheles gambiae translation initiation
           factor protein.
          Length = 110

 Score = 95.9 bits (228), Expect = 1e-21
 Identities = 41/43 (95%), Positives = 42/43 (97%)
 Frame = +3

Query: 339 GTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 467
           GTV+EHPEYGEVLQLQGDQRENICQWLTKSGL KPEQLKVHGF
Sbjct: 68  GTVIEHPEYGEVLQLQGDQRENICQWLTKSGLAKPEQLKVHGF 110



 Score = 74.9 bits (176), Expect = 2e-15
 Identities = 33/39 (84%), Positives = 37/39 (94%)
 Frame = +2

Query: 140 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRR 256
           MSIQNLNTFDPFADAIK ++ DVQDGLVH+RIQQRNGR+
Sbjct: 1   MSIQNLNTFDPFADAIKGADYDVQDGLVHIRIQQRNGRK 39



 Score = 58.4 bits (135), Expect = 2e-10
 Identities = 26/27 (96%), Positives = 27/27 (100%)
 Frame = +1

Query: 256 TLTTVQGLSSEYDLKKIVRACKKEFAC 336
           TLTTVQGLS+EYDLKKIVRACKKEFAC
Sbjct: 40  TLTTVQGLSAEYDLKKIVRACKKEFAC 66


>AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1
            precursor protein.
          Length = 1623

 Score = 25.4 bits (53), Expect = 1.7
 Identities = 13/34 (38%), Positives = 13/34 (38%)
 Frame = +1

Query: 520  DCAXXXXXXXKICI*RAPTSTEKREHGCRACACD 621
            DC        K C   AP      E GC AC CD
Sbjct: 957  DCFCKPGVVGKKCDKCAPAYYGFSEDGCHACDCD 990


>AJ441131-5|CAD29634.1|  574|Anopheles gambiae putative Na+ channel
           protein.
          Length = 574

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 15/46 (32%), Positives = 20/46 (43%)
 Frame = -1

Query: 389 ALKLQHLAVLRVLHDRTLHANSFLHARTIFFRSYSEERPCTVVSVY 252
           A KL+HL   R+        N+F   RT   R + +ER  T    Y
Sbjct: 528 ATKLKHLVHSRLQQANGWVRNTFRSRRTQLGRGFGQERTGTSYPFY 573


>AY331408-1|AAQ97589.1|  100|Anopheles gambiae agCP14332 protein.
          Length = 100

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -2

Query: 352 STTVPCTRTPSCMPARS 302
           +TT PCTR     PAR+
Sbjct: 6   TTTTPCTRRNRTAPARN 22


>AY331407-1|AAQ97588.1|  101|Anopheles gambiae agCP14332 protein.
          Length = 101

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -2

Query: 352 STTVPCTRTPSCMPARS 302
           +TT PCTR     PAR+
Sbjct: 6   TTTTPCTRRNRTAPARN 22


>AY331406-1|AAQ97587.1|   96|Anopheles gambiae agCP14332 protein.
          Length = 96

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -2

Query: 352 STTVPCTRTPSCMPARS 302
           +TT PCTR     PAR+
Sbjct: 6   TTTTPCTRRNRTAPARN 22


>AY331405-1|AAQ97586.1|   96|Anopheles gambiae agCP14332 protein.
          Length = 96

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -2

Query: 352 STTVPCTRTPSCMPARS 302
           +TT PCTR     PAR+
Sbjct: 6   TTTTPCTRRNRTAPARN 22


>AY331404-1|AAQ97585.1|  100|Anopheles gambiae agCP14332 protein.
          Length = 100

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/17 (52%), Positives = 11/17 (64%)
 Frame = -2

Query: 352 STTVPCTRTPSCMPARS 302
           +TT PCTR     PAR+
Sbjct: 6   TTTTPCTRRNRTAPARN 22


>DQ342048-1|ABC69940.1|  847|Anopheles gambiae STIP protein.
          Length = 847

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -3

Query: 249 PFRCWIRTWTK 217
           P  CWI  WT+
Sbjct: 565 PIHCWIHPWTE 575


>DQ139954-1|ABA29475.1|  451|Anopheles gambiae protein
           O-fucosyltransferase 2 protein.
          Length = 451

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -1

Query: 371 LAVLRVLHDRTLHANSFLHARTIFFRSY 288
           LA  +++H  + H       R IFF  Y
Sbjct: 11  LAFSQIVHTTSAHLRELCEKRDIFFEPY 38


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 716,915
Number of Sequences: 2352
Number of extensions: 14992
Number of successful extensions: 36
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71086350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -