SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20076
         (660 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.        27   0.52 
AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium transport...    25   1.6  
M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles ...    24   4.9  
AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform ...    23   6.5  
AY187044-1|AAO39758.1|   87|Anopheles gambiae putative antennal ...    23   8.5  
AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsi...    23   8.5  

>AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.
          Length = 615

 Score = 27.1 bits (57), Expect = 0.52
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 2/54 (3%)
 Frame = +2

Query: 272 ERLRKDTVRIEEEKDSL--LSTLDSIKHSELLLDISECDKDDITRYADRILSRA 427
           ERLR+D  ++EE++     L   D IK  EL+    +  + D  +   R+L  A
Sbjct: 137 ERLRRDKAKVEEDQRHYRELKAADEIKRRELIQKAEDLIQKD--KVGPRVLESA 188


>AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium
           transport-like protein protein.
          Length = 591

 Score = 25.4 bits (53), Expect = 1.6
 Identities = 15/42 (35%), Positives = 21/42 (50%)
 Frame = -3

Query: 559 GNGNAHSLRRCARTSPAIDVHVHLIQSFLLLMVSVSAHCHLY 434
           G G+   +         +DV V LI   L  +VSV+A C+LY
Sbjct: 280 GGGSFSIIYSMINNDGRMDV-VDLINGILASLVSVTAGCYLY 320


>M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 442

 Score = 23.8 bits (49), Expect = 4.9
 Identities = 10/29 (34%), Positives = 16/29 (55%), Gaps = 1/29 (3%)
 Frame = -2

Query: 563 VWQRECALTASLCTDITSYRC-TCSPDTE 480
           VW R C+  +S+C      +C TC+  T+
Sbjct: 17  VWLRSCSCHSSVCAVSFVMQCSTCNAPTD 45


>AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform A
           protein.
          Length = 753

 Score = 23.4 bits (48), Expect = 6.5
 Identities = 10/16 (62%), Positives = 12/16 (75%)
 Frame = -1

Query: 189 GVVVNPLDTQSLMQID 142
           GVV+NPLD Q  +Q D
Sbjct: 492 GVVMNPLDAQCNVQRD 507


>AY187044-1|AAO39758.1|   87|Anopheles gambiae putative antennal
           carrier protein AP-2 protein.
          Length = 87

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = +2

Query: 311 KDSLLSTLDSIKHSELLLDISECDKDDIT 397
           KD+     D +K    L D  + DKD +T
Sbjct: 24  KDAAKDATDKVKDKAALPDAPKLDKDAVT 52


>AJ000675-1|CAA04232.1|  600|Anopheles gambiae infection responsive
           serine proteaselike protein protein.
          Length = 600

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 21/69 (30%), Positives = 27/69 (39%), Gaps = 5/69 (7%)
 Frame = -2

Query: 557 QRECALTASLCTDITSYRCTCSPD--TELPPADG---LGQCALSPLRS*PGTGCGPRIV* 393
           Q +  L A+ C+D T Y   C PD   +LP  +    L QC  +      G  C  R   
Sbjct: 49  QEQLDLRAATCSDATHY---CCPDRSEQLPSRNRPKLLTQCDSNRGYCVKGDACSVRTFR 105

Query: 392 YRPYHTPIY 366
            R    P Y
Sbjct: 106 LRSNRCPAY 114


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 710,962
Number of Sequences: 2352
Number of extensions: 15533
Number of successful extensions: 30
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65650335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -