SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20075
         (715 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954257-9|CAJ14160.1|  573|Anopheles gambiae putative esterase ...    27   0.58 
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    24   4.1  
AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein p...    23   7.2  
AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    23   7.2  
DQ370048-1|ABD18609.1|  144|Anopheles gambiae putative secreted ...    23   9.5  
CR954257-11|CAJ14162.1|  415|Anopheles gambiae predicted protein...    23   9.5  
AY146720-1|AAO12080.1|  147|Anopheles gambiae odorant-binding pr...    23   9.5  

>CR954257-9|CAJ14160.1|  573|Anopheles gambiae putative esterase
           protein.
          Length = 573

 Score = 27.1 bits (57), Expect = 0.58
 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -3

Query: 299 DY-WSSTRPDRIFSCRLDGRLRLHREITPTEI 207
           DY W+  + D +F+  +D  +RLH + TP  +
Sbjct: 412 DYEWTVYQSDHMFAFAIDQTVRLHAQTTPAPL 443


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 11/26 (42%), Positives = 13/26 (50%)
 Frame = +3

Query: 618 QVPSGARGRGNLGDFVLVRGAEGSPG 695
           Q P G RGR  L  +  + G  G PG
Sbjct: 144 QGPKGDRGRDGLPGYPGIPGTNGVPG 169


>AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein
           protein.
          Length = 455

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = -2

Query: 426 CLGTKSQNSVMAFRLSVCGC 367
           CL TK+   +   +L +CGC
Sbjct: 354 CLPTKAAKQLAGRKLRLCGC 373


>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 17/56 (30%), Positives = 23/56 (41%)
 Frame = -3

Query: 713 SSGTCIAWASLSATNEDKVSEISSTPRA*RHLRPLISCSIMKIASCTCSVGTSWEL 546
           S+GT   WAS        + +I S     RH    +   I KI  C+C     W+L
Sbjct: 49  STGTAAIWAS----GRFPIQQIIS-----RHGEGYVIAVINKITFCSCYAPPRWDL 95


>DQ370048-1|ABD18609.1|  144|Anopheles gambiae putative secreted
           polypeptide protein.
          Length = 144

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 492 WTPYKAWPKSSLRRSSFDQLPT 557
           WTP+K  P   + RS+    P+
Sbjct: 54  WTPWKMLPDKFIERSNSSSQPS 75


>CR954257-11|CAJ14162.1|  415|Anopheles gambiae predicted protein
           protein.
          Length = 415

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 13/45 (28%), Positives = 21/45 (46%)
 Frame = +3

Query: 6   RDQNDLTPKTTTNKLRVRKGRSVVHRNLEDNYGAVVIANHEALAQ 140
           R Q +L   +   KL+ +K    VHR   +N+G      H+  +Q
Sbjct: 348 RFQCNLCDMSYRTKLQYQKHEYEVHRISNENFGIKCTICHKLFSQ 392


>AY146720-1|AAO12080.1|  147|Anopheles gambiae odorant-binding
           protein AgamOBP15 protein.
          Length = 147

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 10/31 (32%), Positives = 15/31 (48%)
 Frame = -3

Query: 605 SCSIMKIASCTCSVGTSWELVERASTERRLW 513
           S ++  +A C  S G   +  ERA +  R W
Sbjct: 100 SIALKVLAKCNKSTGPIADACERAYSHHRCW 130


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 793,720
Number of Sequences: 2352
Number of extensions: 18918
Number of successful extensions: 46
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 45
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 73177125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -