SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20074
         (622 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF492429-1|ABP35929.1|  155|Anopheles gambiae lysozyme i-2 protein.    25   1.9  
AY146755-1|AAO12070.1|  320|Anopheles gambiae odorant-binding pr...    24   3.4  
AY146754-1|AAO12069.1|  334|Anopheles gambiae odorant-binding pr...    24   3.4  

>EF492429-1|ABP35929.1|  155|Anopheles gambiae lysozyme i-2 protein.
          Length = 155

 Score = 25.0 bits (52), Expect = 1.9
 Identities = 14/51 (27%), Positives = 21/51 (41%)
 Frame = +2

Query: 392 LLCLSYASGRGLVHSTKVLQKCMTVASILIVDKTVCVDVTCGQFNVPCPVW 544
           LL L+  +G  L +      +C+  AS      T C    CG F++    W
Sbjct: 11  LLSLATVNGAFLSNLNATCFRCICDASTGCSTSTTCRQSYCGPFSISRAYW 61


>AY146755-1|AAO12070.1|  320|Anopheles gambiae odorant-binding
           protein AgamOBP32 protein.
          Length = 320

 Score = 24.2 bits (50), Expect = 3.4
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = -2

Query: 309 SNKVELNV*RSCGGGIERAERE 244
           +N + L V RSC GG + +ER+
Sbjct: 167 ANMLPLTVGRSCAGGSKPSERD 188


>AY146754-1|AAO12069.1|  334|Anopheles gambiae odorant-binding
           protein AgamOBP33 protein.
          Length = 334

 Score = 24.2 bits (50), Expect = 3.4
 Identities = 10/22 (45%), Positives = 15/22 (68%)
 Frame = -2

Query: 309 SNKVELNV*RSCGGGIERAERE 244
           +N + L V RSC GG + +ER+
Sbjct: 167 ANMLPLTVGRSCAGGSKPSERD 188


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 590,659
Number of Sequences: 2352
Number of extensions: 10606
Number of successful extensions: 21
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 60214320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -