SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20070
         (639 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript...    27   0.50 
EF519411-1|ABP68520.1|  165|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519410-1|ABP68519.1|  156|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519409-1|ABP68518.1|  157|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519408-1|ABP68517.1|  157|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519407-1|ABP68516.1|  157|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519406-1|ABP68515.1|  164|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519405-1|ABP68514.1|  164|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519404-1|ABP68513.1|  160|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519403-1|ABP68512.1|  164|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519402-1|ABP68511.1|  176|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519400-1|ABP68509.1|  165|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519399-1|ABP68508.1|  176|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519398-1|ABP68507.1|  165|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519397-1|ABP68506.1|  165|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519396-1|ABP68505.1|  176|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519395-1|ABP68504.1|  164|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519394-1|ABP68503.1|  160|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519393-1|ABP68502.1|  160|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519392-1|ABP68501.1|  163|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519391-1|ABP68500.1|  164|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519390-1|ABP68499.1|  164|Anopheles gambiae ENSANGG00000008286...    25   2.0  
EF519389-1|ABP68498.1|  164|Anopheles gambiae ENSANGG00000008286...    25   2.0  

>AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1222

 Score = 27.1 bits (57), Expect = 0.50
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 332 ALDQDLFTEYKFSVDQLMELAGLSVASAIAKVFPPSTHS 448
           ALD   FTE   S + L  +   +  +A+A+VFP   HS
Sbjct: 249 ALDVASFTERVTSAESLERVMTEACDAAMARVFPSQGHS 287


>EF519411-1|ABP68520.1|  165|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 165

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 108 AMVPFYGQGMNAGFEDCSVLTELFNQ 133


>EF519410-1|ABP68519.1|  156|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 156

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 99  AMVPFYGQGMNAGFEDCSVLTELFNQ 124


>EF519409-1|ABP68518.1|  157|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 157

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 100 AMVPFYGQGMNAGFEDCSVLTELFNQ 125


>EF519408-1|ABP68517.1|  157|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 157

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 100 AMVPFYGQGMNAGFEDCSVLTELFNQ 125


>EF519407-1|ABP68516.1|  157|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 157

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 100 AMVPFYGQGMNAGFEDCSVLTELFNQ 125


>EF519406-1|ABP68515.1|  164|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 164

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519405-1|ABP68514.1|  164|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 164

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519404-1|ABP68513.1|  160|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 160

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519403-1|ABP68512.1|  164|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 164

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519402-1|ABP68511.1|  176|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 176

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519400-1|ABP68509.1|  165|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 165

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 108 AMVPFYGQGMNAGFEDCSVLTELFNQ 133


>EF519399-1|ABP68508.1|  176|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 176

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519398-1|ABP68507.1|  165|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 165

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 108 AMVPFYGQGMNAGFEDCSVLTELFNQ 133


>EF519397-1|ABP68506.1|  165|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 165

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 108 AMVPFYGQGMNAGFEDCSVLTELFNQ 133


>EF519396-1|ABP68505.1|  176|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 176

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519395-1|ABP68504.1|  164|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 164

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519394-1|ABP68503.1|  160|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 160

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519393-1|ABP68502.1|  160|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 160

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519392-1|ABP68501.1|  163|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 163

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519391-1|ABP68500.1|  164|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 164

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519390-1|ABP68499.1|  164|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 164

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


>EF519389-1|ABP68498.1|  164|Anopheles gambiae
           ENSANGG00000008286-like protein.
          Length = 164

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +1

Query: 73  SMIPTYIGNMHIGFK*NIILTDIWNQ 150
           +M+P Y   M+ GF+   +LT+++NQ
Sbjct: 119 AMVPFYGQGMNAGFEDCSVLTELFNQ 144


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 673,830
Number of Sequences: 2352
Number of extensions: 14043
Number of successful extensions: 56
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 56
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 62723250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -