SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase ...    27   0.38 
AY745227-1|AAU93494.1|   99|Anopheles gambiae cytochrome P450 pr...    25   2.0  
AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T...    23   6.1  

>AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase
           protein.
          Length = 849

 Score = 27.5 bits (58), Expect = 0.38
 Identities = 12/41 (29%), Positives = 24/41 (58%)
 Frame = -1

Query: 618 FFRSKYFVAL*SLYLNMRFAVLFNDLEGEELNIMLYSWSLH 496
           FF  +Y + L  L+ +M    ++ND+  + +NI   +WS++
Sbjct: 446 FFGGRYIILLMGLF-SMYTGFVYNDIFSKSMNIFGSAWSVN 485


>AY745227-1|AAU93494.1|   99|Anopheles gambiae cytochrome P450
           protein.
          Length = 99

 Score = 25.0 bits (52), Expect = 2.0
 Identities = 13/49 (26%), Positives = 21/49 (42%), Gaps = 3/49 (6%)
 Frame = -1

Query: 318 PTHE*VVPKSIPITVPMSLSFSSCRRHKRPR---PPKLARTNSTAS*PC 181
           P H+ V+P  +PI +P+       +    P    P + A+ N     PC
Sbjct: 32  PLHDYVIPNGMPIMIPIYAIHRDPKYFPNPTVFDPERFAKENLDQIQPC 80


>AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr
           phosphatase protein.
          Length = 1978

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 19/77 (24%), Positives = 31/77 (40%), Gaps = 9/77 (11%)
 Frame = +2

Query: 197 VEFVRASFGGRGRLCRRQEEKDKDIGTV---------IGIDLGTTYSCVGVYKNGRVEII 349
           +  +R SF    +LC  Q +  K +G +          G+   +   C  + +NGR  ++
Sbjct: 359 IHVIRKSFHALRQLCASQADIPKWLGLLERTLWLQHLSGLLAASMVVCHAIERNGRPVLV 418

Query: 350 ANDQGNRITPSYVAFTQ 400
               G   TP  VA  Q
Sbjct: 419 HCSDGWDRTPQIVATAQ 435


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 677,372
Number of Sequences: 2352
Number of extensions: 14474
Number of successful extensions: 14
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 62305095
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -