SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.           26   1.1  
AY118045-1|AAM54226.1|   69|Anopheles gambiae xanthine dehydroge...    25   2.6  
AY118043-1|AAM54224.1|   69|Anopheles gambiae xanthine dehydroge...    25   2.6  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            23   7.9  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            23   7.9  

>AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein.
          Length = 1459

 Score = 25.8 bits (54), Expect = 1.1
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +2

Query: 509 GVHDLYAVNLSNNNLKSLHPETF 577
           G++ L  ++L NN L  +HPE F
Sbjct: 438 GLYALSLLSLDNNALTGVHPEAF 460



 Score = 24.2 bits (50), Expect = 3.4
 Identities = 10/31 (32%), Positives = 19/31 (61%)
 Frame = +2

Query: 485 VISPQCFPGVHDLYAVNLSNNNLKSLHPETF 577
           VI    F G+++LY + L +NN+++   + F
Sbjct: 501 VIEEPGFRGMNNLYGLRLISNNIENFTRKAF 531


>AY118045-1|AAM54226.1|   69|Anopheles gambiae xanthine
           dehydrogenase protein.
          Length = 69

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
 Frame = +2

Query: 191 DADNLLDQYEDYEPAEY--QEVLSTRTGPVPETAYALYLRD 307
           + D LL Q++  +P  +       T  GP PE    +YLR+
Sbjct: 4   ETDGLLPQFDTNQPLVFFVNGKKVTDDGPDPECTLLMYLRE 44


>AY118043-1|AAM54224.1|   69|Anopheles gambiae xanthine
           dehydrogenase protein.
          Length = 69

 Score = 24.6 bits (51), Expect = 2.6
 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 2/41 (4%)
 Frame = +2

Query: 191 DADNLLDQYEDYEPAEY--QEVLSTRTGPVPETAYALYLRD 307
           + D LL Q++  +P  +       T  GP PE    +YLR+
Sbjct: 4   ETDGLLPQFDTNQPLVFFVNGKKVTDDGPDPECTLLMYLRE 44


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +3

Query: 6   EEHRYYAVQDSKN 44
           EEHRYY ++D  +
Sbjct: 484 EEHRYYLIKDGSS 496


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 23.0 bits (47), Expect = 7.9
 Identities = 7/13 (53%), Positives = 10/13 (76%)
 Frame = +3

Query: 6   EEHRYYAVQDSKN 44
           EEHRYY ++D  +
Sbjct: 485 EEHRYYLIKDGSS 497


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 624,963
Number of Sequences: 2352
Number of extensions: 12440
Number of successful extensions: 30
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60553008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -