SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide recepto...    23   6.3  
EF519478-2|ABP73566.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519477-2|ABP73564.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519476-2|ABP73562.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519475-2|ABP73560.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519474-2|ABP73558.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519473-2|ABP73556.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519472-2|ABP73554.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519471-2|ABP73552.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519470-2|ABP73550.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519469-2|ABP73548.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519467-2|ABP73544.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519466-2|ABP73542.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519465-2|ABP73540.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519464-2|ABP73538.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519463-2|ABP73536.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519461-2|ABP73532.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519460-2|ABP73530.1|  166|Anopheles gambiae CTL4 protein.            23   8.3  
EF519459-2|ABP73528.1|  166|Anopheles gambiae CTL4 protein.            23   8.3  
EF519458-2|ABP73526.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519457-2|ABP73524.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519456-2|ABP73522.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519455-2|ABP73520.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519454-2|ABP73518.1|  161|Anopheles gambiae CTL4 protein.            23   8.3  
EF519452-2|ABP73514.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519451-2|ABP73512.1|  171|Anopheles gambiae CTL4 protein.            23   8.3  
EF519450-2|ABP73510.1|  171|Anopheles gambiae CTL4 protein.            23   8.3  
EF519449-2|ABP73508.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519448-2|ABP73506.1|  171|Anopheles gambiae CTL4 protein.            23   8.3  
EF519447-2|ABP73504.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519446-2|ABP73502.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519445-2|ABP73500.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519444-2|ABP73498.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519443-2|ABP73496.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519442-2|ABP73494.1|  177|Anopheles gambiae CTL4 protein.            23   8.3  
EF519441-2|ABP73492.1|  164|Anopheles gambiae CTL4 protein.            23   8.3  
EF519440-2|ABP73490.1|  165|Anopheles gambiae CTL4 protein.            23   8.3  
EF519439-2|ABP73488.1|  152|Anopheles gambiae CTL4 protein.            23   8.3  
EF519438-2|ABP73486.1|  161|Anopheles gambiae CTL4 protein.            23   8.3  
EF519437-2|ABP73484.1|  165|Anopheles gambiae CTL4 protein.            23   8.3  

>AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide receptor
           protein.
          Length = 493

 Score = 23.4 bits (48), Expect = 6.3
 Identities = 13/64 (20%), Positives = 26/64 (40%)
 Frame = -3

Query: 452 IIIHWKILQSIFFVQNNYKSSFQSHTSNEVKIVDSHRALARCVERCDVCCHMTLTCTNCY 273
           + IHW  +  ++F+  +  S F      +V+  +  R      E+ ++     L C    
Sbjct: 260 VYIHWLYMIFVYFLPFSLISFFNLMIYRQVRRANKERQRLSRSEKREIGLATMLICVVIV 319

Query: 272 ALIC 261
            L+C
Sbjct: 320 FLLC 323


>EF519478-2|ABP73566.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519477-2|ABP73564.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519476-2|ABP73562.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519475-2|ABP73560.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519474-2|ABP73558.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519473-2|ABP73556.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519472-2|ABP73554.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519471-2|ABP73552.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519470-2|ABP73550.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519469-2|ABP73548.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519467-2|ABP73544.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519466-2|ABP73542.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519465-2|ABP73540.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519464-2|ABP73538.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519463-2|ABP73536.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519461-2|ABP73532.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519460-2|ABP73530.1|  166|Anopheles gambiae CTL4 protein.
          Length = 166

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 37  GGKLYTTPNLRLNWFDAV 54


>EF519459-2|ABP73528.1|  166|Anopheles gambiae CTL4 protein.
          Length = 166

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 37  GGKLYTTPNLRLNWFDAV 54


>EF519458-2|ABP73526.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519457-2|ABP73524.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519456-2|ABP73522.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519455-2|ABP73520.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519454-2|ABP73518.1|  161|Anopheles gambiae CTL4 protein.
          Length = 161

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 32  GGKLYTTPNLRLNWFDAV 49


>EF519452-2|ABP73514.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519451-2|ABP73512.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 42  GGKLYTTPNLRLNWFDAV 59


>EF519450-2|ABP73510.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 42  GGKLYTTPNLRLNWFDAV 59


>EF519449-2|ABP73508.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519448-2|ABP73506.1|  171|Anopheles gambiae CTL4 protein.
          Length = 171

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 42  GGKLYTTPNLRLNWFDAV 59


>EF519447-2|ABP73504.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519446-2|ABP73502.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519445-2|ABP73500.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519444-2|ABP73498.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519443-2|ABP73496.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519442-2|ABP73494.1|  177|Anopheles gambiae CTL4 protein.
          Length = 177

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 48  GGKLYTTPNLRLNWFDAV 65


>EF519441-2|ABP73492.1|  164|Anopheles gambiae CTL4 protein.
          Length = 164

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 35  GGKLYTTPNLRLNWFDAV 52


>EF519440-2|ABP73490.1|  165|Anopheles gambiae CTL4 protein.
          Length = 165

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 36  GGKLYTTPNLRLNWFDAV 53


>EF519439-2|ABP73488.1|  152|Anopheles gambiae CTL4 protein.
          Length = 152

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 23  GGKLYTTPNLRLNWFDAV 40


>EF519438-2|ABP73486.1|  161|Anopheles gambiae CTL4 protein.
          Length = 161

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 32  GGKLYTTPNLRLNWFDAV 49


>EF519437-2|ABP73484.1|  165|Anopheles gambiae CTL4 protein.
          Length = 165

 Score = 23.0 bits (47), Expect = 8.3
 Identities = 9/18 (50%), Positives = 12/18 (66%)
 Frame = -3

Query: 233 GGRLYTGPNLAMYFLTKV 180
           GG+LYT PNL + +   V
Sbjct: 36  GGKLYTTPNLRLNWFDAV 53


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 657,792
Number of Sequences: 2352
Number of extensions: 14187
Number of successful extensions: 59
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 59
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 59
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 63977715
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -