SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF437889-1|AAL84184.1|  155|Anopheles gambiae odorant binding pr...    24   5.1  
AY146725-1|AAO12085.1|  155|Anopheles gambiae odorant-binding pr...    23   6.7  
AY146724-1|AAO12084.1|  151|Anopheles gambiae odorant-binding pr...    23   6.7  
AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.        23   6.7  
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    23   6.7  
AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein p...    23   6.7  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            23   8.9  

>AF437889-1|AAL84184.1|  155|Anopheles gambiae odorant binding
           protein protein.
          Length = 155

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 11/49 (22%), Positives = 24/49 (48%)
 Frame = +3

Query: 60  AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 206
           A ++L ++   ++ +  R VC      S ++A   + G FP++    C+
Sbjct: 33  AQQSLTQADMDEIAKGMRKVCMSRPKISEEMANYPSQGIFPDDKEFKCY 81


>AY146725-1|AAO12085.1|  155|Anopheles gambiae odorant-binding
           protein AgamOBP6 protein.
          Length = 155

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 11/49 (22%), Positives = 24/49 (48%)
 Frame = +3

Query: 60  AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 206
           A ++L ++   ++ +  R VC      S ++A   + G FP++    C+
Sbjct: 33  AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDQEFKCY 81


>AY146724-1|AAO12084.1|  151|Anopheles gambiae odorant-binding
           protein AgamOBP18 protein.
          Length = 151

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 11/49 (22%), Positives = 24/49 (48%)
 Frame = +3

Query: 60  AFEALKRSQSMDVGQTWRCVCTETVNRSPQVARVLAPGDFPEESSEVCF 206
           A ++L ++   ++ +  R VC      S ++A   + G FP++    C+
Sbjct: 29  AQQSLTQADMDEIAKGMRKVCMSRHKISEEMANYPSQGIFPDDKEFKCY 77


>AJ439353-11|CAD27933.1|  615|Anopheles gambiae 30E5.11 protein.
          Length = 615

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = -2

Query: 482 ADGAAIMRYQVRNILRSGRHTLDFTQLVLS 393
           AD AA +RY   +  +  RH L + Q ++S
Sbjct: 483 ADTAAELRYAKEHADKENRHFLQYAQDLIS 512


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
            growth factor receptorprotein.
          Length = 1433

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +1

Query: 604  GACGHHRVPARDIPALRHCAHQ 669
            GA  +  VPA+D+P L    H+
Sbjct: 1033 GARPYENVPAKDVPELIEIGHK 1054


>AB090816-1|BAC57907.1|  455|Anopheles gambiae gag-like protein
           protein.
          Length = 455

 Score = 23.4 bits (48), Expect = 6.7
 Identities = 15/60 (25%), Positives = 22/60 (36%)
 Frame = -2

Query: 239 CFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLSNIHALGAFKRFKC 60
           C +    + PV    +R  R + RG  +R+   PVD   A         +A       KC
Sbjct: 373 CISSIMEAMPVSVDRQRCYRCLERGHLARDCQSPVDRQQACIRCGADGHYAKSCTSEIKC 432


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 11/23 (47%), Positives = 13/23 (56%)
 Frame = +2

Query: 611  VGTIVFPRETSRLFDIVHIKDST 679
            V T  FP ET  +FDI  I  +T
Sbjct: 1448 VDTTHFPTETKLVFDISFIPSTT 1470


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 797,478
Number of Sequences: 2352
Number of extensions: 17640
Number of successful extensions: 81
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 78
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 81
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68577420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -