SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY943929-1|AAX49502.1|  755|Anopheles gambiae laccase-2 isoform ...    25   1.5  
AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform ...    25   1.5  
AJ000502-1|CAA04136.1|  299|Anopheles gambiae iron regulatory pr...    23   8.1  

>AY943929-1|AAX49502.1|  755|Anopheles gambiae laccase-2 isoform B
           protein.
          Length = 755

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +3

Query: 351 CSEACQRSRPTRIAYY 398
           C+ AC+   P RI YY
Sbjct: 151 CARACREGEPPRICYY 166


>AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform A
           protein.
          Length = 753

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +3

Query: 351 CSEACQRSRPTRIAYY 398
           C+ AC+   P RI YY
Sbjct: 151 CARACREGEPPRICYY 166


>AJ000502-1|CAA04136.1|  299|Anopheles gambiae iron regulatory
           protein protein.
          Length = 299

 Score = 23.0 bits (47), Expect = 8.1
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%)
 Frame = +1

Query: 316 VTPANTDLANSDALKLAKE--VDPQGLRTIGVIT-KLDLMDEGTDARDVLENKLLP 474
           ++PA +   NS A +   +  + P+   + G      D+M  GT A   L NKL+P
Sbjct: 90  ISPAGSIARNSPAARFLSDRGLTPRDFNSYGSRRGNDDIMARGTFANIRLVNKLVP 145


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 663,073
Number of Sequences: 2352
Number of extensions: 13564
Number of successful extensions: 30
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 30
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 62305095
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -