SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           27   0.52 
AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.          25   2.1  
DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.       23   4.8  
AY280613-1|AAQ21366.1|  257|Anopheles gambiae carbonic anhydrase...    23   4.8  
AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript...    23   4.8  
AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative transcrip...    23   6.4  
AJ130951-1|CAA10260.1|  189|Anopheles gambiae SG3 protein protein.     23   6.4  
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    23   6.4  

>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 26.6 bits (56), Expect = 0.52
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +2

Query: 326  RQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPP 427
            R++  +R +E  +L  EA  A +  N + QP PP
Sbjct: 1101 REEDERRTEERRQLHNEANRAYRQRNRRSQPTPP 1134


>AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein.
          Length = 1132

 Score = 24.6 bits (51), Expect = 2.1
 Identities = 13/48 (27%), Positives = 23/48 (47%)
 Frame = +2

Query: 311 KHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGT 454
           KH  C  +     +E +++ KEA    +T+NL +     +A  +  GT
Sbjct: 323 KHRLCELNREPTEREEQQMQKEAAVMARTMNLNQVCLCFRAYRVEPGT 370


>DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.
          Length = 410

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 10/36 (27%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
 Frame = +3

Query: 183 HKVYHGKTGRVYN-VTAHALGVIVNSVFAEGLYRSA 287
           H   HG+   + + ++A  + +IVN+++  GL+  A
Sbjct: 92  HNQTHGRIADIVSHISADTILMIVNTLYFRGLWEEA 127


>AY280613-1|AAQ21366.1|  257|Anopheles gambiae carbonic anhydrase
           alternate isoform protein.
          Length = 257

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 8/17 (47%), Positives = 11/17 (64%)
 Frame = -1

Query: 263 EHAVDNHTESMSSHVVH 213
           EH ++  T SM +H VH
Sbjct: 90  EHTLEGSTYSMEAHAVH 106


>AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1022

 Score = 23.4 bits (48), Expect = 4.8
 Identities = 10/21 (47%), Positives = 13/21 (61%)
 Frame = -2

Query: 166 TAPLPLMSTMSPTLYTFMYVE 104
           TA +P  S + PTL+  MY E
Sbjct: 607 TAGVPQGSVLGPTLWNLMYNE 627


>AJ438610-4|CAD27476.1|  593|Anopheles gambiae putative
           transcription factor protein.
          Length = 593

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +2

Query: 71  LAVPHTWNYSALHVHESVQS 130
           + V +TWNY+A  V + V S
Sbjct: 280 VGVENTWNYTAADVADLVDS 299


>AJ130951-1|CAA10260.1|  189|Anopheles gambiae SG3 protein protein.
          Length = 189

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 8/18 (44%), Positives = 13/18 (72%)
 Frame = -2

Query: 226 VTLYTRPVFPWYTLCGIP 173
           V ++ RP  PW+++ GIP
Sbjct: 73  VGIFGRPGRPWWSVPGIP 90


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein.
          Length = 2051

 Score = 23.0 bits (47), Expect = 6.4
 Identities = 10/27 (37%), Positives = 12/27 (44%)
 Frame = -3

Query: 525  FLKIFYGLYATNSYGIGASKTGFSVPL 445
            FLK   G Y  N Y I     G  +P+
Sbjct: 1735 FLKAILGQYKQNDYNIDIIPHGHELPM 1761


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 563,934
Number of Sequences: 2352
Number of extensions: 11146
Number of successful extensions: 35
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35
length of database: 563,979
effective HSP length: 60
effective length of database: 422,859
effective search space used: 49051644
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -