SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p...    26   0.76 
AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase ...    26   0.76 
AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase ...    26   1.0  
AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript...    25   2.3  
DQ974170-1|ABJ52810.1|  511|Anopheles gambiae serpin 12 protein.       24   3.1  
U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.         24   4.0  
U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.         24   4.0  
AB090817-1|BAC57909.1|  344|Anopheles gambiae gag-like protein p...    23   5.3  
DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren...    23   7.1  
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    23   7.1  
AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript...    23   7.1  

>AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein
            protein.
          Length = 3325

 Score = 26.2 bits (55), Expect = 0.76
 Identities = 10/42 (23%), Positives = 22/42 (52%), Gaps = 2/42 (4%)
 Frame = +3

Query: 303  KRPLVDLRNPGPPQHQEHET--QNPEHHEDAEKIVSSVKNDI 422
            KR  + L++   P   ++ T    P+HH++   ++  +KN +
Sbjct: 1603 KRDRIILQDESEPNTSQYSTFIHEPKHHQEDPPVLKYIKNQV 1644


>AJ439060-8|CAD27759.1|  808|Anopheles gambiae putative V-ATPase
           protein.
          Length = 808

 Score = 26.2 bits (55), Expect = 0.76
 Identities = 10/32 (31%), Positives = 18/32 (56%)
 Frame = -2

Query: 428 CVNVIFDGRNDFFSIFVVFRILCFVLLMLRGP 333
           C   +F+G++    IF+V  ++C   L+L  P
Sbjct: 619 CKEFMFEGQDTLQVIFIVLGLICIPWLLLAKP 650


>AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase
           protein.
          Length = 849

 Score = 25.8 bits (54), Expect = 1.0
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = -2

Query: 428 CVNVIFDGRNDFFSIFVVFRILCFVLLMLRGP 333
           C   +F+G+N+    FV   +LC   ++L  P
Sbjct: 630 CDEFMFEGQNELQRTFVFIALLCIPWMLLGKP 661


>AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1049

 Score = 24.6 bits (51), Expect = 2.3
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +1

Query: 61  QPAIPDKVPEAEDKPLNVVDNLSSEQELI 147
           +P  P   P A  +PL +VDNL+  QE++
Sbjct: 520 KPGKPPGHPSAF-RPLGLVDNLAKVQEMV 547


>DQ974170-1|ABJ52810.1|  511|Anopheles gambiae serpin 12 protein.
          Length = 511

 Score = 24.2 bits (50), Expect = 3.1
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 6/48 (12%)
 Frame = +1

Query: 97  DKPLNVVDNLSSEQELIDQANTIKDIDN------SLRANKKEVIDIPV 222
           D+P   +D +  E+E+I+++N   D DN      S  +N K+++D  V
Sbjct: 88  DEPKTSLDPVVVEEEIIEESNG-PDGDNLVLEQGSNNSNSKDIVDFEV 134


>U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.8 bits (49), Expect = 4.0
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = +3

Query: 261 DLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHE 383
           D  +V VP     IK+  +    P P Q   H  Q+P HH+
Sbjct: 63  DEMSVVVPISPLHIKQEPLGSDGPMPAQPPHHH-QHPHHHQ 102


>U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.8 bits (49), Expect = 4.0
 Identities = 14/41 (34%), Positives = 19/41 (46%)
 Frame = +3

Query: 261 DLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHE 383
           D  +V VP     IK+  +    P P Q   H  Q+P HH+
Sbjct: 63  DEMSVVVPISPLHIKQEPLGSDGPMPAQPPHHH-QHPHHHQ 102


>AB090817-1|BAC57909.1|  344|Anopheles gambiae gag-like protein
           protein.
          Length = 344

 Score = 23.4 bits (48), Expect = 5.3
 Identities = 12/47 (25%), Positives = 21/47 (44%), Gaps = 2/47 (4%)
 Frame = +3

Query: 303 KRPLVDLRNPGPP--QHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 437
           +RP+ D + PGP   Q  + + Q P       + V ++ +  N   I
Sbjct: 47  RRPVADDQQPGPSGLQRLQQQQQQPSRLTPVREAVENIPSPRNGPNI 93


>DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative
           methoprene-tolerant protein protein.
          Length = 1115

 Score = 23.0 bits (47), Expect = 7.1
 Identities = 8/27 (29%), Positives = 12/27 (44%)
 Frame = +3

Query: 324 RNPGPPQHQEHETQNPEHHEDAEKIVS 404
           ++PG  QH  H   +  HH   +   S
Sbjct: 176 QHPGHSQHHHHHHHHHPHHSQQQHSAS 202


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
            growth factor receptorprotein.
          Length = 1433

 Score = 23.0 bits (47), Expect = 7.1
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = +3

Query: 342  QHQEHETQNPEHHEDAEKIVSS 407
            QHQ+H+    +HH   +   SS
Sbjct: 1321 QHQQHQQHQLQHHHQPQLSQSS 1342


>AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1222

 Score = 23.0 bits (47), Expect = 7.1
 Identities = 12/33 (36%), Positives = 16/33 (48%)
 Frame = +3

Query: 294 EEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAE 392
           E ++RP  D R    P  +E  T+    H DAE
Sbjct: 212 ELLQRPAADSRRQEGPSTRESGTRWRTRHFDAE 244


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 497,091
Number of Sequences: 2352
Number of extensions: 9393
Number of successful extensions: 79
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 75
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 79
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 54245403
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -