SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY137766-1|AAM94344.1|   78|Anopheles gambiae heat shock protein...   130   6e-32
AB090814-1|BAC57903.1|  499|Anopheles gambiae gag-like protein p...    25   2.5  
AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.           25   3.3  
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           25   3.3  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            24   4.4  
AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           24   5.9  
AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.           24   5.9  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          23   7.7  

>AY137766-1|AAM94344.1|   78|Anopheles gambiae heat shock protein 70
           protein.
          Length = 78

 Score =  130 bits (313), Expect = 6e-32
 Identities = 61/70 (87%), Positives = 66/70 (94%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK   GERNVLIFDLGGGTF
Sbjct: 6   VPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTF 65

Query: 688 DVSILTIEDG 717
           DVSILTI++G
Sbjct: 66  DVSILTIDEG 75


>AB090814-1|BAC57903.1|  499|Anopheles gambiae gag-like protein
           protein.
          Length = 499

 Score = 25.0 bits (52), Expect = 2.5
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = +2

Query: 188 SVLCCVHRHRASHRRCRQEPGGVNPNNTI 274
           SVL C +  R     C   P G+N N ++
Sbjct: 10  SVLGCAYTQRTKCAACLDSPDGMNGNESL 38


>AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 24.6 bits (51), Expect = 3.3
 Identities = 8/33 (24%), Positives = 15/33 (45%)
 Frame = -2

Query: 752 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 654
           W+ P    T+ +P++         PPP +  +T
Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.6 bits (51), Expect = 3.3
 Identities = 8/33 (24%), Positives = 15/33 (45%)
 Frame = -2

Query: 752 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 654
           W+ P    T+ +P++         PPP +  +T
Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 24.2 bits (50), Expect = 4.4
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%)
 Frame = +2

Query: 74   NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 175
            +GK  RS +   +++LL    P REG  H+  Q PG
Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837


>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 752 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 654
           W+ P    T+  P++         PPP +  +T
Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254


>AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.8 bits (49), Expect = 5.9
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 752 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 654
           W+ P    T+ +P +         PPP +  +T
Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.4 bits (48), Expect = 7.7
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%)
 Frame = -2

Query: 749 VSPAVDFTSKIPSSMVRMDTSKVPPP---RSKI---------STFRS-PVPF-LSRP*AI 612
           +SP  +F++    S++ ++ +  PPP   RSK           T RS PVPF L+ P A 
Sbjct: 439 ISPPAEFSNGSSKSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAA 498

Query: 611 AAAVGSLMIR 582
           + A G   +R
Sbjct: 499 SPAFGDRSVR 508


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 870,833
Number of Sequences: 2352
Number of extensions: 19051
Number of successful extensions: 39
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 37
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 78586767
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -