SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY578808-1|AAT07313.1|  458|Anopheles gambiae saxophone protein.       25   2.2  
AJ515150-1|CAD56157.2|  737|Anopheles gambiae acetylcholinestera...    25   2.9  
AJ515149-1|CAD56156.1|  737|Anopheles gambiae acetylcholinestera...    25   2.9  
AJ488492-1|CAD32684.2|  623|Anopheles gambiae acetylcholinestera...    25   2.9  
AJ416109-1|CAC94781.1|  234|Anopheles gambiae PROSAg25 protein p...    23   8.9  

>AY578808-1|AAT07313.1|  458|Anopheles gambiae saxophone protein.
          Length = 458

 Score = 25.0 bits (52), Expect = 2.2
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = +1

Query: 454 YKIPCKNCTGIYCSNSHIP 510
           Y I C  CTG YC+N   P
Sbjct: 92  YNIEC--CTGDYCNNGSFP 108


>AJ515150-1|CAD56157.2|  737|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 737

 Score = 24.6 bits (51), Expect = 2.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -1

Query: 542 HVLISNVAIVYGICEFEQYIPV 477
           HVL++N     GICEF  ++PV
Sbjct: 434 HVLVNNEWGTLGICEF-PFVPV 454


>AJ515149-1|CAD56156.1|  737|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 737

 Score = 24.6 bits (51), Expect = 2.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -1

Query: 542 HVLISNVAIVYGICEFEQYIPV 477
           HVL++N     GICEF  ++PV
Sbjct: 434 HVLVNNEWGTLGICEF-PFVPV 454


>AJ488492-1|CAD32684.2|  623|Anopheles gambiae acetylcholinesterase
           protein.
          Length = 623

 Score = 24.6 bits (51), Expect = 2.9
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = -1

Query: 542 HVLISNVAIVYGICEFEQYIPV 477
           HVL++N     GICEF  ++PV
Sbjct: 320 HVLVNNEWGTLGICEF-PFVPV 340


>AJ416109-1|CAC94781.1|  234|Anopheles gambiae PROSAg25 protein
           protein.
          Length = 234

 Score = 23.0 bits (47), Expect = 8.9
 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%)
 Frame = +1

Query: 241 QKYS--ISLRPAVHEVDLEWRHGRGGHVTLQDEDVTTKTLNGWRKLN 375
           ++YS  + L  AVH   L  + G  G +   + +V     NG+R+L+
Sbjct: 176 KRYSEDLELDDAVHTAILTLKEGFEGQMNADNIEVGICDANGFRRLD 222


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 655,795
Number of Sequences: 2352
Number of extensions: 12278
Number of successful extensions: 80
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 80
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 80
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68159265
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -