SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ370039-1|ABD18600.1|  168|Anopheles gambiae putative TIL domai...    25   1.7  
AF457552-1|AAL68782.1|  311|Anopheles gambiae D7 protein long fo...    24   5.1  
DQ004399-1|AAY21238.1|  847|Anopheles gambiae lysozyme c-6 protein.    23   9.0  

>DQ370039-1|ABD18600.1|  168|Anopheles gambiae putative TIL domain
           polypeptide protein.
          Length = 168

 Score = 25.4 bits (53), Expect = 1.7
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +1

Query: 406 INKCPNLRAPLSLTEEGLHWTRMMKICK*LLV*VHISCLNIIINILHVF 552
           I KC N   PLS T   + + R++  C  L V +  + +N I++ +  F
Sbjct: 86  IPKCSNENMPLSKTSTAILFVRLVTPCLYLRVNIDSNPVNHIMDRMENF 134


>AF457552-1|AAL68782.1|  311|Anopheles gambiae D7 protein long form
           protein.
          Length = 311

 Score = 23.8 bits (49), Expect = 5.1
 Identities = 8/20 (40%), Positives = 14/20 (70%)
 Frame = -1

Query: 72  WVTIHNKSINILRKLYISTL 13
           ++ +HNK I + RK+Y  T+
Sbjct: 135 YLPVHNKYIGVSRKIYHGTV 154


>DQ004399-1|AAY21238.1|  847|Anopheles gambiae lysozyme c-6 protein.
          Length = 847

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = -2

Query: 356 NLTHLGHSTDHVFNHGSFLWSTQFDCVQSGSG 261
           N + LG+  + V  HG F  S ++ C   G G
Sbjct: 537 NSSALGYGPNGVQYHGMFQLSDEYWCSPPGRG 568


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 607,940
Number of Sequences: 2352
Number of extensions: 10680
Number of successful extensions: 24
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68995575
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -