SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript...    29   0.16 
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            26   1.5  
DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.            25   2.0  
CR954256-5|CAJ14146.1|  615|Anopheles gambiae predicted protein ...    24   6.1  
AF515471-1|AAM61879.1|  225|Anopheles gambiae glutathione S-tran...    24   6.1  
AF491816-1|AAM09542.2|  225|Anopheles gambiae glutathione S-tran...    24   6.1  
AF164152-1|AAD47076.1|  261|Anopheles gambiae ribosomal protein ...    24   6.1  
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    23   8.0  
AJ237706-1|CAB40347.1|  570|Anopheles gambiae putative 5'-nucleo...    23   8.0  
AF046924-1|AAC08530.1|  122|Anopheles gambiae mucin protein.           23   8.0  

>AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1201

 Score = 29.1 bits (62), Expect = 0.16
 Identities = 17/41 (41%), Positives = 21/41 (51%)
 Frame = +3

Query: 93  DGQEAEYPQHVCDRPRRSRQVNPHGLVGFQGRYHCWCESRR 215
           D   A   QH+  RP+RS + NP       GR H  C+SRR
Sbjct: 273 DENPAGAQQHLSHRPQRSTRKNP------AGRQHDRCDSRR 307


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 25.8 bits (54), Expect = 1.5
 Identities = 11/38 (28%), Positives = 19/38 (50%)
 Frame = -1

Query: 379 SIKLIKKPFSLFSRWSGFVMNTKSFSSSSKNIEMAVDL 266
           +++L+KKP SL S W       +       N ++A+ L
Sbjct: 156 TVRLLKKPPSLDSEWKSSTSTIQLIEQLDSNKQLAIAL 193


>DQ655702-1|ABG45862.1|  889|Anopheles gambiae Jxc1 protein.
          Length = 889

 Score = 25.4 bits (53), Expect = 2.0
 Identities = 12/38 (31%), Positives = 19/38 (50%)
 Frame = +1

Query: 172 LVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLRPSL 285
           +V + G++ G    ET     RK+  +R+ PL  R  L
Sbjct: 804 MVLQEGVVEGGTKDETDMERERKEMVERSRPLRKRKRL 841


>CR954256-5|CAJ14146.1|  615|Anopheles gambiae predicted protein
           protein.
          Length = 615

 Score = 23.8 bits (49), Expect = 6.1
 Identities = 15/52 (28%), Positives = 23/52 (44%)
 Frame = +1

Query: 463 CLVCVYKLKQYCVRLCRAHQAYSVHEQNGPCSS*APT*S*RTIPDVPAYCRK 618
           C+VC +   Q CVRL +A +      +    SS  P       P +  +CR+
Sbjct: 354 CVVCDFTCHQQCVRLEKAIKTGMNSLRTVRASSFGPMRRRSGSPTLHIHCRR 405


>AF515471-1|AAM61879.1|  225|Anopheles gambiae glutathione
           S-transferase 3-8 protein.
          Length = 225

 Score = 23.8 bits (49), Expect = 6.1
 Identities = 9/27 (33%), Positives = 17/27 (62%)
 Frame = +3

Query: 243 RTRPCITIKSTAISMFFELEEKDLVFI 323
           ++ PC  +K TA ++  EL EK++  +
Sbjct: 13  KSPPCRAVKLTARALGIELVEKEMTLL 39


>AF491816-1|AAM09542.2|  225|Anopheles gambiae glutathione
           S-transferase E7 protein.
          Length = 225

 Score = 23.8 bits (49), Expect = 6.1
 Identities = 9/27 (33%), Positives = 17/27 (62%)
 Frame = +3

Query: 243 RTRPCITIKSTAISMFFELEEKDLVFI 323
           ++ PC  +K TA ++  EL EK++  +
Sbjct: 13  KSPPCRAVKLTARALGIELVEKEMTLL 39


>AF164152-1|AAD47076.1|  261|Anopheles gambiae ribosomal protein L8
           protein.
          Length = 261

 Score = 23.8 bits (49), Expect = 6.1
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -1

Query: 487 SVCTHTPDTQSTTTRAPS 434
           SV  H PDT+ T  + PS
Sbjct: 135 SVIAHNPDTKRTRVKLPS 152


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
           polyprotein protein.
          Length = 1726

 Score = 23.4 bits (48), Expect = 8.0
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = +3

Query: 108 EYPQHVCDRPRRSRQVNPHGLVGFQG 185
           ++P HVC+R  R+  +N   +V   G
Sbjct: 350 QHPLHVCERFERASVINREEIVRKHG 375


>AJ237706-1|CAB40347.1|  570|Anopheles gambiae putative
           5'-nucleotidase protein.
          Length = 570

 Score = 23.4 bits (48), Expect = 8.0
 Identities = 10/31 (32%), Positives = 17/31 (54%), Gaps = 5/31 (16%)
 Frame = +2

Query: 461 CVWCVCTN*NSTASGYAER-----IKPILFM 538
           C WC CT  +  A  YA++     ++P+ F+
Sbjct: 366 CRWCECTLGDLIADAYADQYTNSTVQPVAFV 396


>AF046924-1|AAC08530.1|  122|Anopheles gambiae mucin protein.
          Length = 122

 Score = 23.4 bits (48), Expect = 8.0
 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -1

Query: 496 STVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKST-CPGES 377
           +TV+  T T    +TTT AP+ T + A      +T  PG++
Sbjct: 34  TTVAPTTTTVAPTTTTTVAPTTTTTVAPGQTTTTTVAPGQT 74


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 857,491
Number of Sequences: 2352
Number of extensions: 18183
Number of successful extensions: 38
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 81497388
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -