SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY545988-1|AAS99341.1|  423|Anopheles gambiae carboxypeptidase B...    30   0.091
AJ627286-1|CAF28572.1|  423|Anopheles gambiae carboxypeptidase B...    30   0.091
U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette...    25   2.6  
U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette...    25   2.6  
U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette...    25   2.6  
AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein p...    24   4.5  
AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic acetylch...    24   6.0  
AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic acetylch...    24   6.0  
AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.    24   6.0  

>AY545988-1|AAS99341.1|  423|Anopheles gambiae carboxypeptidase B
           precursor protein.
          Length = 423

 Score = 29.9 bits (64), Expect = 0.091
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMT--WKQYHRLEDIYGFMDYL 682
           ++  I+Y++V ED+Q+ +N E          L+     R T  ++ +  L++IY ++D L
Sbjct: 81  EQHDIEYDLVAEDVQELLNREQRRNVEHGRRLRRDSNSRATVNFEHFWTLDEIYEYLDEL 140

Query: 683 A 685
           A
Sbjct: 141 A 141


>AJ627286-1|CAF28572.1|  423|Anopheles gambiae carboxypeptidase B
           protein.
          Length = 423

 Score = 29.9 bits (64), Expect = 0.091
 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDNDEIELQDRRGHRMT--WKQYHRLEDIYGFMDYL 682
           ++  I+Y++V ED+Q+ +N E          L+     R T  ++ +  L++IY ++D L
Sbjct: 81  EQHDIEYDLVAEDVQELLNREQRRNVEHGRRLRRDSNSRATVNFEHFWTLDEIYEYLDEL 140

Query: 683 A 685
           A
Sbjct: 141 A 141


>U29486-1|AAC46995.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 25.0 bits (52), Expect = 2.6
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -1

Query: 237 CLFCLVISYRLSYRIALW 184
           CLF L++ +RL   + LW
Sbjct: 671 CLFALIVLFRLGALLCLW 688


>U29485-1|AAC46994.1|  695|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 695

 Score = 25.0 bits (52), Expect = 2.6
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -1

Query: 237 CLFCLVISYRLSYRIALW 184
           CLF L++ +RL   + LW
Sbjct: 671 CLFALIVLFRLGALLCLW 688


>U29484-1|AAC47423.1|  673|Anopheles gambiae ATP-binding-cassette
           protein protein.
          Length = 673

 Score = 25.0 bits (52), Expect = 2.6
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -1

Query: 237 CLFCLVISYRLSYRIALW 184
           CLF L++ +RL   + LW
Sbjct: 649 CLFALIVLFRLGALLCLW 666


>AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein
           protein.
          Length = 353

 Score = 24.2 bits (50), Expect = 4.5
 Identities = 13/43 (30%), Positives = 17/43 (39%)
 Frame = -2

Query: 215 ATGCLTELRCGHSSPGCSSLIRGELRTTVRAAKNNTTVCLLDP 87
           A  C   L  GH++  C+   R  L     AA +    C  DP
Sbjct: 288 AVRCFRCLERGHTTADCAGEDRSSLCLHCGAADHRAASCTSDP 330


>AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 23.8 bits (49), Expect = 6.0
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -3

Query: 124 PPRTTRPFASWIPWLLNV 71
           PP     F  W+PW+L +
Sbjct: 329 PPWIKSVFLQWLPWILRM 346


>AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 23.8 bits (49), Expect = 6.0
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -3

Query: 124 PPRTTRPFASWIPWLLNV 71
           PP     F  W+PW+L +
Sbjct: 329 PPWIKSVFLQWLPWILRM 346


>AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein.
          Length = 1187

 Score = 23.8 bits (49), Expect = 6.0
 Identities = 11/27 (40%), Positives = 18/27 (66%)
 Frame = +2

Query: 539 IEDLQKRINEENPPLDNDEIELQDRRG 619
           +++LQK I ++   L   E+E+Q RRG
Sbjct: 331 LKNLQKSIRDDEQALAGKEVEMQ-RRG 356


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 744,734
Number of Sequences: 2352
Number of extensions: 14479
Number of successful extensions: 23
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 80249979
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -