SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y09951-1|CAA71082.1|  107|Anopheles gambiae histone H2a protein.       27   0.40 
AY534996-1|AAT07394.1|  471|Anopheles gambiae XK-related b protein.    26   0.92 
AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.    25   2.1  
AF045250-1|AAC02700.1|  259|Anopheles gambiae serine proteinase ...    25   2.1  
AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.8  
AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.8  
AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.8  
AY341184-1|AAR13748.1|  187|Anopheles gambiae GNBP A1 protein.         25   2.8  
AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.         25   2.8  
AY214334-1|AAP69612.1|  519|Anopheles gambiae nicotinate phospho...    25   2.8  
M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles ...    24   3.7  
AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubu...    23   6.5  
AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome convers...    23   8.5  

>Y09951-1|CAA71082.1|  107|Anopheles gambiae histone H2a protein.
          Length = 107

 Score = 27.5 bits (58), Expect = 0.40
 Identities = 16/73 (21%), Positives = 36/73 (49%)
 Frame = +1

Query: 115 HLCAIISFLPIRISDCVTSFTMGDSLLKEDPLSRIQREIIEVTERERNLKKVTSESTGLC 294
           +L A++ +L   + +   +    D+  +   + R+Q  I    E  + L++VT    G+ 
Sbjct: 35  YLAAVMEYLAAEVLELAGNRAR-DNKKERRIIPRLQLAIRNDEEENKLLRRVTIAQGGVL 93

Query: 295 PNLRSTLIIRMDT 333
           PN+++ L+ +  T
Sbjct: 94  PNIQAVLLPKRTT 106


>AY534996-1|AAT07394.1|  471|Anopheles gambiae XK-related b protein.
          Length = 471

 Score = 26.2 bits (55), Expect = 0.92
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +2

Query: 506 IIASKGKLPPPSNAASTPNT 565
           I  S   +PPPSN  S+P+T
Sbjct: 451 ISCSSNSIPPPSNHCSSPST 470


>AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein.
          Length = 1201

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 14/44 (31%), Positives = 25/44 (56%)
 Frame = +1

Query: 139 LPIRISDCVTSFTMGDSLLKEDPLSRIQREIIEVTERERNLKKV 270
           L + ISD ++    GD+  KE     ++R  I + E+E+ L++V
Sbjct: 305 LDLTISD-LSDEVQGDNKSKERAEQELERLKITIAEKEKELEQV 347


>AF045250-1|AAC02700.1|  259|Anopheles gambiae serine proteinase
           protein.
          Length = 259

 Score = 25.0 bits (52), Expect = 2.1
 Identities = 10/40 (25%), Positives = 17/40 (42%)
 Frame = +2

Query: 368 PQQSGLHFTFVRAHRPLDSCSACCPHRKWLHASIHSADRY 487
           P Q  L + F    R    CS    +++W+  + H  + Y
Sbjct: 34  PYQVSLQWNFNNGSRARHFCSGSIINQRWILTAAHCLEEY 73


>AY341187-1|AAR13751.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = -1

Query: 581 GEGRWPYSVLRPHLKAGAAFLCWL 510
           G+GRW +   +P L  G     W+
Sbjct: 73  GDGRWTFDTNKPALPNGTIIYYWV 96


>AY341186-1|AAR13750.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = -1

Query: 581 GEGRWPYSVLRPHLKAGAAFLCWL 510
           G+GRW +   +P L  G     W+
Sbjct: 73  GDGRWTFDTNKPALPNGTIIYYWV 96


>AY341185-1|AAR13749.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = -1

Query: 581 GEGRWPYSVLRPHLKAGAAFLCWL 510
           G+GRW +   +P L  G     W+
Sbjct: 73  GDGRWTFDTNKPALPNGTIIYYWV 96


>AY341184-1|AAR13748.1|  187|Anopheles gambiae GNBP A1 protein.
          Length = 187

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = -1

Query: 581 GEGRWPYSVLRPHLKAGAAFLCWL 510
           G+GRW +   +P L  G     W+
Sbjct: 73  GDGRWTFDTNKPALPNGTIIYYWV 96


>AY341183-1|AAR13747.1|  189|Anopheles gambiae GNBP A1 protein.
          Length = 189

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = -1

Query: 581 GEGRWPYSVLRPHLKAGAAFLCWL 510
           G+GRW +   +P L  G     W+
Sbjct: 73  GDGRWTFDTNKPALPNGTIIYYWV 96


>AY214334-1|AAP69612.1|  519|Anopheles gambiae nicotinate
           phosphoribosyltransferase-like protein protein.
          Length = 519

 Score = 24.6 bits (51), Expect = 2.8
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = -1

Query: 287 PVDSEVTFFKFLSLSVTSMISLWILDSGSSFKSESPMVKL 168
           P   E  FF++LS      ++L+ ++ GS      P++K+
Sbjct: 61  PQGIEDEFFEYLSQLTAKDVTLYAIEEGSVAFPRVPLIKV 100


>M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 442

 Score = 24.2 bits (50), Expect = 3.7
 Identities = 9/16 (56%), Positives = 12/16 (75%)
 Frame = -1

Query: 506 SLHYSFCTGLRSESTR 459
           S H++ CTGL  +STR
Sbjct: 58  SKHHTHCTGLSRDSTR 73


>AJ438610-1|CAD27473.1|  838|Anopheles gambiae putative microtubule
           binding protein protein.
          Length = 838

 Score = 23.4 bits (48), Expect = 6.5
 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 1/24 (4%)
 Frame = +2

Query: 521 GKLPPP-SNAASTPNTAIAPPLIF 589
           G+LP   S+A ++PN A APP  F
Sbjct: 362 GRLPADNSSALNSPNPARAPPRNF 385


>AJ459959-1|CAD31058.1|  462|Anopheles gambiae dopachrome conversion
           enzyme protein.
          Length = 462

 Score = 23.0 bits (47), Expect = 8.5
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = -1

Query: 317 INVDRRFGHKPVDSEVTFFKF 255
           +N  +RFG +  +  VTFF+F
Sbjct: 415 VNSAQRFGDENNNDRVTFFEF 435


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 655,697
Number of Sequences: 2352
Number of extensions: 13497
Number of successful extensions: 32
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 65650335
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -