SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein p...    30   0.081
AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different...    25   1.7  
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    25   2.3  
AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    24   4.0  
AY578796-1|AAT07301.1|  437|Anopheles gambiae Gbb-60A protein.         24   5.3  
Y17700-1|CAA76820.1|  122|Anopheles gambiae hypothetical protein...    23   7.0  

>AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein
           protein.
          Length = 724

 Score = 29.9 bits (64), Expect = 0.081
 Identities = 14/34 (41%), Positives = 19/34 (55%)
 Frame = +1

Query: 526 GERRISPRARPQAGE*RHQQHPGGHQDLREQLQR 627
           GER + P+ R Q  + +HQQ     Q  R+Q QR
Sbjct: 294 GERYVPPQLRQQRQQQQHQQQQQQQQQQRQQQQR 327


>AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative
           differentiation regulator protein.
          Length = 1283

 Score = 25.4 bits (53), Expect = 1.7
 Identities = 13/32 (40%), Positives = 16/32 (50%)
 Frame = +2

Query: 224 HSVTSAPSPSG*VAHHGADLLQHDEETDPGGS 319
           HS  S+ SP G  +HH   L  H  +  P GS
Sbjct: 803 HSALSSHSPVGAGSHHLHHLHHHAAQQPPPGS 834


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
           polyprotein protein.
          Length = 1726

 Score = 25.0 bits (52), Expect = 2.3
 Identities = 15/55 (27%), Positives = 26/55 (47%)
 Frame = +2

Query: 515 NTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           NT     ASA   A++  + V    +E      S  ND+++ D++SG   + + K
Sbjct: 828 NTITYGTASAPFLAIRTLNQVLEDNKEKYPLAASRINDFYVDDFISGADSENEAK 882


>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
           growth factor receptorprotein.
          Length = 1433

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 13/22 (59%), Positives = 17/22 (77%)
 Frame = -3

Query: 624 LKLLSQVLMTSRMLLVTSLSSL 559
           LKLL+ V MTS+M+L+T L  L
Sbjct: 897 LKLLA-VCMTSQMMLITQLMPL 917


>AY578796-1|AAT07301.1|  437|Anopheles gambiae Gbb-60A protein.
          Length = 437

 Score = 23.8 bits (49), Expect = 5.3
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +2

Query: 278 DLLQHDEETDPGGSGRVNPVLS 343
           D LQ +E   P G+GR+  V S
Sbjct: 98  DQLQQEETDAPAGAGRIRKVRS 119


>Y17700-1|CAA76820.1|  122|Anopheles gambiae hypothetical protein
           protein.
          Length = 122

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = -1

Query: 557 GRARGLMRRSPTTCLRGPVRDEVGYGACQLSPHEQVVNEL 438
           G+  G + ++ TT             AC +S HEQ   EL
Sbjct: 34  GQHYGXLLKASTTWNEKECNGSTKLAACVVSEHEQAYREL 73


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 667,222
Number of Sequences: 2352
Number of extensions: 13466
Number of successful extensions: 33
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 31
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71504505
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -