SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20037
         (718 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY137766-1|AAM94344.1|   78|Anopheles gambiae heat shock protein...    48   3e-07
AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.           25   3.1  
AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.           25   3.1  
AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein p...    25   3.1  
AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.           24   5.4  
AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.           24   5.4  
AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.            23   9.5  
AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.           23   9.5  
AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.           23   9.5  
AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.           23   9.5  
AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein prot...    23   9.5  

>AY137766-1|AAM94344.1|   78|Anopheles gambiae heat shock protein 70
           protein.
          Length = 78

 Score = 48.0 bits (109), Expect = 3e-07
 Identities = 21/23 (91%), Positives = 23/23 (100%)
 Frame = +2

Query: 11  RNVLIFDLGGGTFDVSILTIEDG 79
           RNVLIFDLGGGTFDVSILTI++G
Sbjct: 53  RNVLIFDLGGGTFDVSILTIDEG 75


>AY344831-1|AAR05802.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 8/33 (24%), Positives = 15/33 (45%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+ +P++         PPP +  +T
Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253


>AY344829-1|AAR05800.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 8/33 (24%), Positives = 15/33 (45%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+ +P++         PPP +  +T
Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254


>AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein
           protein.
          Length = 353

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 20/54 (37%), Positives = 24/54 (44%)
 Frame = -3

Query: 269 CVDDDRSSLPSHMQYANA*ELSCW*RGPFCISS*TPGQSG*PCDCQSPHLPSGC 108
           C  +DRSSL  H   A+    SC    P CI    P +   P  C+ P  PS C
Sbjct: 304 CAGEDRSSLCLHCGAADHRAASCT-SDPKCIVCGGPHRIAAPM-CKGP--PSQC 353


>AY344835-1|AAR05806.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+  P++         PPP +  +T
Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254


>AY344830-1|AAR05801.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+ +P +         PPP +  +T
Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254


>AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein.
          Length = 3361

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = -1

Query: 439  VQYRGFEPYPSWHHGE 392
            + Y GFEPY   H G+
Sbjct: 1335 ISYYGFEPYERNHFGK 1350


>AY344834-1|AAR05805.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+  P++         PPP +  +T
Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254


>AY344833-1|AAR05804.1|  334|Anopheles gambiae ICHIT protein.
          Length = 334

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+  P++         PPP +  +T
Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254


>AY344832-1|AAR05803.1|  333|Anopheles gambiae ICHIT protein.
          Length = 333

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+  P++         PPP +  +T
Sbjct: 221 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 253


>AJ010903-1|CAA09389.1|  373|Anopheles gambiae ICHIT protein
           protein.
          Length = 373

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/33 (24%), Positives = 14/33 (42%)
 Frame = -2

Query: 114 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 16
           W+ P    T+  P++         PPP +  +T
Sbjct: 222 WIDPTATTTTHAPTTTTTWSDLPPPPPTTTTTT 254


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 765,281
Number of Sequences: 2352
Number of extensions: 15649
Number of successful extensions: 45
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 40
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 45
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 72765525
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -