SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          24   5.4  
AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.            23   9.5  
AF185643-1|AAF15578.1|  117|Anopheles gambiae Toll-related prote...    23   9.5  
AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22...    23   9.5  
AF080565-1|AAC31945.1|  324|Anopheles gambiae Antennapedia homeo...    23   9.5  

>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +2

Query: 515  IHQEDWLQPSCCRFRAHFWMARRQHVGAFNQN 610
            I  + WLQ    + RA     RR+H  +F+ N
Sbjct: 990  ISGQSWLQLQQQKLRARREQQRREHSNSFSYN 1021


>AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein.
          Length = 1356

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/23 (34%), Positives = 15/23 (65%)
 Frame = +2

Query: 488  LRKSRRKILIHQEDWLQPSCCRF 556
            +  SRR I++  E++++   CRF
Sbjct: 1136 VESSRRTIMVLSENFIKSEWCRF 1158


>AF185643-1|AAF15578.1|  117|Anopheles gambiae Toll-related protein
           protein.
          Length = 117

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/23 (34%), Positives = 15/23 (65%)
 Frame = +2

Query: 488 LRKSRRKILIHQEDWLQPSCCRF 556
           +  SRR I++  E++++   CRF
Sbjct: 50  VESSRRTIMVLSENFIKSEWCRF 72


>AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D
           protein.
          Length = 1322

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 16/41 (39%), Positives = 18/41 (43%)
 Frame = -1

Query: 422 TPRVKASKACSRV*PFLEIPASNSPVPAATMSTAQSA*EVP 300
           T R  AS   S   P   IPA + PVPA      QS   +P
Sbjct: 354 TSRPVASGPTSHYYPS-HIPAGSQPVPAVVNPHQQSRPTIP 393


>AF080565-1|AAC31945.1|  324|Anopheles gambiae Antennapedia homeotic
           protein protein.
          Length = 324

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = +1

Query: 154 YAWVLDKLKAERERRYHNRYCSLEV 228
           Y W+  + + +R R+ + RY +LE+
Sbjct: 235 YPWMRSQFERKRGRQTYTRYQTLEL 259


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 805,939
Number of Sequences: 2352
Number of extensions: 17215
Number of successful extensions: 28
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 27
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 73177125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -