SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein ...    47   5e-07
AY745221-1|AAU93488.1|   95|Anopheles gambiae cytochrome P450 pr...    25   1.8  
AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide recepto...    25   1.8  
AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript...    25   3.1  
AJ439060-9|CAD27760.1|  348|Anopheles gambiae putative translati...    23   9.5  

>AY957503-1|AAY41942.1|  596|Anopheles gambiae vasa-like protein
           protein.
          Length = 596

 Score = 47.2 bits (107), Expect = 5e-07
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D+L   M    F  +++HGD  QRERE+ +  F++G   VLI T
Sbjct: 427 LVFVETKRNADYLASLMSETQFPTTSIHGDRLQREREMALYDFKSGRMDVLIAT 480



 Score = 34.7 bits (76), Expect = 0.003
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (1%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFV-TEADRRALKDI 426
           ARG+D++ V+ V+NYDLP + ++Y                 +F   EADR    D+
Sbjct: 484 ARGLDIKNVNHVVNYDLPKSIDDYVHRIGRTGRVGNKGRATSFYDPEADRAMASDL 539


>AY745221-1|AAU93488.1|   95|Anopheles gambiae cytochrome P450
           protein.
          Length = 95

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)
 Frame = +3

Query: 510 ILCPAFYCDIYKVCVLG-QDS*LPNTAEFLLEL 605
           +LC  F CD+   C  G Q + L N    LLE+
Sbjct: 18  LLCQCFTCDVVGSCAFGLQCNSLKNGGSKLLEI 50


>AY299455-1|AAQ73620.1|  493|Anopheles gambiae FMRF amide receptor
           protein.
          Length = 493

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 13/48 (27%), Positives = 26/48 (54%)
 Frame = +3

Query: 117 RWIGSLNLCICVTLLYLLCMETWINVSVK*S*GSFVLALLVS*SPLFI 260
           R IG   + ICV +++LLC    + +++  +  S ++  +V  S L +
Sbjct: 305 REIGLATMLICVVIVFLLCNLPAMMINIVEAFYSLIIEYMVKVSNLLV 352


>AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1201

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +2

Query: 461 PVMWPTSSKAPT 496
           PV WP SS APT
Sbjct: 469 PVSWPVSSDAPT 480


>AJ439060-9|CAD27760.1|  348|Anopheles gambiae putative translation
           initiation factor protein.
          Length = 348

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 13/40 (32%), Positives = 17/40 (42%)
 Frame = -1

Query: 292 RKLAVHQYHVPINSGDQDTRRASTKLPHDHFTLTLIHVSM 173
           R L  H Y       +Q  R  + +L HD    TL+  SM
Sbjct: 184 RNLLEHVYCTETRPYNQGARLTAYELVHDKLPATLVTDSM 223


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 741,912
Number of Sequences: 2352
Number of extensions: 14206
Number of successful extensions: 18
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 73177125
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -