SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.    29   0.18 
DQ383819-1|ABD38144.1|  377|Anopheles gambiae abdominal-B protein.     25   3.0  
AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    25   3.0  
AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein...    24   4.0  
U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.         23   7.0  
U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.         23   7.0  
DQ370037-1|ABD18598.1|  121|Anopheles gambiae putative TIL domai...    23   9.2  
AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    23   9.2  

>AY645021-1|AAT92557.1|  163|Anopheles gambiae even-skipped protein.
          Length = 163

 Score = 28.7 bits (61), Expect = 0.18
 Identities = 13/31 (41%), Positives = 17/31 (54%)
 Frame = -3

Query: 622 PAPYVPIQIKNSQRSQCDTTSKTNTHQLYRQ 530
           P+PY P+ +  SQ    DT   T  HQL+ Q
Sbjct: 47  PSPYAPLSMSKSQTPPQDTVG-TAQHQLHHQ 76


>DQ383819-1|ABD38144.1|  377|Anopheles gambiae abdominal-B protein.
          Length = 377

 Score = 24.6 bits (51), Expect = 3.0
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +3

Query: 231 GEVLAQ*IRRVPPSASAQFPGGAGRTKSG 317
           G V++   + VPPSA+++ PG      SG
Sbjct: 99  GAVVSPATQIVPPSAASESPGSVSSQPSG 127


>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
            protein.
          Length = 1154

 Score = 24.6 bits (51), Expect = 3.0
 Identities = 12/39 (30%), Positives = 19/39 (48%)
 Frame = +2

Query: 260  GSAECVRAISRRGREDKIRLSAKMARMEMPQLQHQTNSR 376
            G    + + S R  E +  + A+MAR+     QHQ + R
Sbjct: 1071 GERPSMPSSSPRTSERRANIRARMARLRQRHRQHQQDER 1109


>AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein
           coupled receptor protein.
          Length = 695

 Score = 24.2 bits (50), Expect = 4.0
 Identities = 7/22 (31%), Positives = 14/22 (63%)
 Frame = +2

Query: 593 LYLYWNVRSGVSNLELHRYHWI 658
           +Y+ ++  S +   E+HRY W+
Sbjct: 302 VYVLFSYASSIDRFEVHRYCWM 323


>U42429-1|AAB54088.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 74  RHLDEGNIGGGSHGAC 27
           R  +EG  G GSHG C
Sbjct: 346 RIANEGGTGCGSHGCC 361


>U42214-1|AAB58461.1|  596|Anopheles gambiae engrailed protein.
          Length = 596

 Score = 23.4 bits (48), Expect = 7.0
 Identities = 9/16 (56%), Positives = 10/16 (62%)
 Frame = -2

Query: 74  RHLDEGNIGGGSHGAC 27
           R  +EG  G GSHG C
Sbjct: 346 RIANEGGTGCGSHGCC 361


>DQ370037-1|ABD18598.1|  121|Anopheles gambiae putative TIL domain
           polypeptide protein.
          Length = 121

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 9/18 (50%), Positives = 10/18 (55%)
 Frame = -2

Query: 56  NIGGGSHGACLQHKVSSC 3
           NI  G H AC +H V  C
Sbjct: 79  NIRRGDHLACTKHCVEGC 96


>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 23.0 bits (47), Expect = 9.2
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = -2

Query: 437 LSLVVVSIVVPTGLLLLGLAPCCWFDVVAEASPS 336
           +++ V++ +VP  L+L   + CC F  V+ A  S
Sbjct: 803 VAVCVIASMVPICLILAEDSECCSFSGVSNAGLS 836


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 674,604
Number of Sequences: 2352
Number of extensions: 13946
Number of successful extensions: 23
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 70668195
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -