SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20024
         (560 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine...    27   0.32 
AF395079-1|AAK97461.1|  371|Anopheles gambiae basic helix-loop-h...    27   0.42 
EF426222-1|ABO26465.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426221-1|ABO26464.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426220-1|ABO26463.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426219-1|ABO26462.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426218-1|ABO26461.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426217-1|ABO26460.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426216-1|ABO26459.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426215-1|ABO26458.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426214-1|ABO26457.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426213-1|ABO26456.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426212-1|ABO26455.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426211-1|ABO26454.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426210-1|ABO26453.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426209-1|ABO26452.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426208-1|ABO26451.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426207-1|ABO26450.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426206-1|ABO26449.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426205-1|ABO26448.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426204-1|ABO26447.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426203-1|ABO26446.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426202-1|ABO26445.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426201-1|ABO26444.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426200-1|ABO26443.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426199-1|ABO26442.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426198-1|ABO26441.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426197-1|ABO26440.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426196-1|ABO26439.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426195-1|ABO26438.1|   94|Anopheles gambiae unknown protein.         25   1.3  
EF426224-1|ABO26467.1|   94|Anopheles gambiae unknown protein.         25   1.7  
EF426223-1|ABO26466.1|   94|Anopheles gambiae unknown protein.         25   1.7  
AB090820-1|BAC57915.1|  527|Anopheles gambiae gag-like protein p...    25   2.2  
AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha ...    24   3.0  
AJ441131-1|CAD29630.1|  567|Anopheles gambiae putative chitin bi...    24   3.0  
AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcript...    23   5.2  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   6.8  

>AJ459779-1|CAD30839.1|  405|Anopheles gambiae clip-domain serine
           protease protein.
          Length = 405

 Score = 27.5 bits (58), Expect = 0.32
 Identities = 9/18 (50%), Positives = 14/18 (77%)
 Frame = +1

Query: 289 FNIHSNPGIVSDNNLQQC 342
           +NIH+NP  V +N+L+ C
Sbjct: 204 YNIHTNPDCVYENDLKDC 221


>AF395079-1|AAK97461.1|  371|Anopheles gambiae basic
           helix-loop-helix transcriptionfactor ASH protein.
          Length = 371

 Score = 27.1 bits (57), Expect = 0.42
 Identities = 14/43 (32%), Positives = 17/43 (39%)
 Frame = +3

Query: 318 LGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQS 446
           LG   A    PG  P  ++  G       + Y   PY TP QS
Sbjct: 58  LGGHRANAKLPGAGPIVSSSSGSGNSSKKYAYCGLPYATPQQS 100


>EF426222-1|ABO26465.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426221-1|ABO26464.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426220-1|ABO26463.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426219-1|ABO26462.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426218-1|ABO26461.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426217-1|ABO26460.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426216-1|ABO26459.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426215-1|ABO26458.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426214-1|ABO26457.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426213-1|ABO26456.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426212-1|ABO26455.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426211-1|ABO26454.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426210-1|ABO26453.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426209-1|ABO26452.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426208-1|ABO26451.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426207-1|ABO26450.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426206-1|ABO26449.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426205-1|ABO26448.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426204-1|ABO26447.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426203-1|ABO26446.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426202-1|ABO26445.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426201-1|ABO26444.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426200-1|ABO26443.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426199-1|ABO26442.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426198-1|ABO26441.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426197-1|ABO26440.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426196-1|ABO26439.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426195-1|ABO26438.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.4 bits (53), Expect = 1.3
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSAAVFSTVSCGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426224-1|ABO26467.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 1.7
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSATVFSTVSSGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>EF426223-1|ABO26466.1|   94|Anopheles gambiae unknown protein.
          Length = 94

 Score = 25.0 bits (52), Expect = 1.7
 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 5/54 (9%)
 Frame = -1

Query: 464 FNCCIIAL-----GWCHIRIALITKCTMWCHMAARCSWCWRDSWVRHCCRLLSE 318
           ++CC++ L      +  +   L T C + C   A    C R + + +CC   SE
Sbjct: 5   YSCCVVVLLLSATVFSTVSSGLGTPCKVLCENGAEMIPCDRKTEIFNCCGPCSE 58


>AB090820-1|BAC57915.1|  527|Anopheles gambiae gag-like protein
           protein.
          Length = 527

 Score = 24.6 bits (51), Expect = 2.2
 Identities = 11/38 (28%), Positives = 16/38 (42%)
 Frame = +2

Query: 263 KLSCAWL*CSTFIPTRV*SRTTTCSNVLPRNHASTNCT 376
           +L   +  CS     +V  + T C   L R H +  CT
Sbjct: 443 RLELGYTYCSVHEAPKVSGQLTRCFRCLERGHIAATCT 480


>AY027891-1|AAK15783.1|  801|Anopheles gambiae collagen IV alpha 1
           chain precursor protein.
          Length = 801

 Score = 24.2 bits (50), Expect = 3.0
 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 2/42 (4%)
 Frame = +3

Query: 303 QPGYS--LGQQPAAMSYPGITPAPTAPRGHVTPHGAFGYQSY 422
           QPG +   G        PG  P P  PRG+  P G  G   +
Sbjct: 393 QPGIAGPAGAPGGGEGRPG-APGPKGPRGYEGPQGPKGMDGF 433


>AJ441131-1|CAD29630.1|  567|Anopheles gambiae putative chitin
           binding protein protein.
          Length = 567

 Score = 24.2 bits (50), Expect = 3.0
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%)
 Frame = +3

Query: 306 PGYSLGQ-QPAAMSYPGITPAPTAPRGHVTPHGAFGYQSYPYVTPTQSYDTTIEWVP 473
           PG  + Q +P A++    + AP  P+G + P G     S  Y++P  S  T    +P
Sbjct: 62  PGAPIQQSRPQAVTVR--SSAPMLPKGGLPPKGVPSSASPVYMSPASSLMTKATSLP 116


>AB090815-2|BAC57906.1|  973|Anopheles gambiae reverse transcriptase
           protein.
          Length = 973

 Score = 23.4 bits (48), Expect = 5.2
 Identities = 15/55 (27%), Positives = 23/55 (41%), Gaps = 9/55 (16%)
 Frame = -3

Query: 306 VGMNVEHYNQAQDNLVVLRLARRWSICRI---------VERWVNWSLGWGIIWVS 169
           V +N+ H  + QD L  L +  +  +  +         V  WV+ S G   IW S
Sbjct: 4   VQLNLNHCEEVQDMLGQLLIEEKGDVAMLSEPYRCPSGVNNWVSDSTGTAAIWAS 58



 Score = 23.4 bits (48), Expect = 5.2
 Identities = 10/37 (27%), Positives = 20/37 (54%)
 Frame = -2

Query: 127 LKFQNTRNTYLITAQNSEFRDPTFRLGRYRSEILRHL 17
           L+  + +  +LI + +   +  + R+G  R E +RHL
Sbjct: 669 LEIAHKKTEFLIISSHKTVQSGSIRVGDERIESIRHL 705


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 6.8
 Identities = 9/24 (37%), Positives = 14/24 (58%)
 Frame = +1

Query: 280  VIMFNIHSNPGIVSDNNLQQCLTQ 351
            V+ F +HS    V+  N +QCL +
Sbjct: 1521 VVDFAMHSKTAFVASVNARQCLIE 1544


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 620,533
Number of Sequences: 2352
Number of extensions: 12879
Number of successful extensions: 56
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 55
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 52563375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -