SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20022
         (392 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L20837-1|AAA03087.1|  192|Anopheles gambiae ribosomal protein S7...    24   2.3  
AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr...    23   4.0  
AF080565-1|AAC31945.1|  324|Anopheles gambiae Antennapedia homeo...    23   5.3  
AJ297933-1|CAC35453.2|  392|Anopheles gambiae Ag9 protein protein.     22   7.0  

>L20837-1|AAA03087.1|  192|Anopheles gambiae ribosomal protein S7
           protein.
          Length = 192

 Score = 23.8 bits (49), Expect = 2.3
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +2

Query: 122 YAGKHCVYVYRAKKRTPIPGGPRGKKNQAACYLGQGDPPTWQLWRVRAKFKSNL--PAQA 295
           ++GKH V++  A++R  +P   RG+++       Q  P +  +  V      +L  PA+ 
Sbjct: 85  FSGKHVVFI--AERRI-LPKPMRGRRDPNK----QKRPRSPNVTAVYDAILEDLVFPAEV 137

Query: 296 MGHRIRVMLYPSRI 337
           +G RIRV L  S++
Sbjct: 138 VGKRIRVKLDGSQL 151


>AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase
           protein.
          Length = 1253

 Score = 23.0 bits (47), Expect = 4.0
 Identities = 9/14 (64%), Positives = 10/14 (71%)
 Frame = +3

Query: 234 RPHGNSGVSEPSSS 275
           RP GN G S PSS+
Sbjct: 829 RPEGNRGPSSPSST 842


>AF080565-1|AAC31945.1|  324|Anopheles gambiae Antennapedia homeotic
           protein protein.
          Length = 324

 Score = 22.6 bits (46), Expect = 5.3
 Identities = 14/60 (23%), Positives = 21/60 (35%)
 Frame = +2

Query: 158 KKRTPIPGGPRGKKNQAACYLGQGDPPTWQLWRVRAKFKSNLPAQAMGHRIRVMLYPSRI 337
           K +  +  GP G           G PP  Q+       +  +P   MGH      YP ++
Sbjct: 122 KLQAAVGNGPNGLGTYGT---ENGSPPLDQMGHHMGTAQMTIPQHHMGHSQGQECYPEQV 178


>AJ297933-1|CAC35453.2|  392|Anopheles gambiae Ag9 protein protein.
          Length = 392

 Score = 22.2 bits (45), Expect = 7.0
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 213 HAAWFFLPR 187
           H  WFFLPR
Sbjct: 317 HRRWFFLPR 325


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 417,579
Number of Sequences: 2352
Number of extensions: 9064
Number of successful extensions: 21
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 21
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 21
length of database: 563,979
effective HSP length: 58
effective length of database: 427,563
effective search space used: 30784536
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -