SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20019
         (587 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146742-1|AAO12102.1|  154|Anopheles gambiae odorant-binding pr...    27   0.45 
AF437890-1|AAL84185.1|  154|Anopheles gambiae odorant binding pr...    27   0.45 
AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi...    26   1.0  
AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium transport...    25   1.4  
M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles ...    24   3.2  
EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc...    23   7.3  

>AY146742-1|AAO12102.1|  154|Anopheles gambiae odorant-binding
           protein AgamOBP7 protein.
          Length = 154

 Score = 27.1 bits (57), Expect = 0.45
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = -1

Query: 95  HELWLAWKRRDHA*TRTCRDERAPLAPATSC 3
           HE+ +A         RTC D   P APA  C
Sbjct: 45  HEICIAESGASEEQLRTCLDGTVPTAPAAKC 75


>AF437890-1|AAL84185.1|  154|Anopheles gambiae odorant binding
           protein protein.
          Length = 154

 Score = 27.1 bits (57), Expect = 0.45
 Identities = 12/31 (38%), Positives = 14/31 (45%)
 Frame = -1

Query: 95  HELWLAWKRRDHA*TRTCRDERAPLAPATSC 3
           HE+ +A         RTC D   P APA  C
Sbjct: 45  HEICIAESGASEEQLRTCLDGTVPTAPAAKC 75


>AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA
            topoisomerase protein.
          Length = 1039

 Score = 25.8 bits (54), Expect = 1.0
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 6/63 (9%)
 Frame = -3

Query: 549  SRECILSTSSMFRSRPIRSDEDYSQKSP------ISASVKFMEFIRSANLKVESTRNLHW 388
            SR  I +T  M +  P  +    S  SP      ++++      + +A + +    NLH+
Sbjct: 855  SRRLITATGGMLKMPPSSNSSPSSYPSPDVVISGLASNNSSSSNLVAAGMVINDENNLHY 914

Query: 387  HRS 379
            HRS
Sbjct: 915  HRS 917


>AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium
           transport-like protein protein.
          Length = 591

 Score = 25.4 bits (53), Expect = 1.4
 Identities = 12/51 (23%), Positives = 24/51 (47%)
 Frame = -1

Query: 404 RETCIGTALDGVSLHQLPIETDDTIKRSVKHTDESHEQCIEQTTFEQREFH 252
           R T IG +    +L  + ++ DD I       +  HE+C+++     ++ H
Sbjct: 447 RHTQIGISRALSALAPIQLDLDDVIDAPPIGRNPGHERCVDEIEAASQKLH 497


>M93689-1|AAA29368.1|  442|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 442

 Score = 24.2 bits (50), Expect = 3.2
 Identities = 9/17 (52%), Positives = 10/17 (58%)
 Frame = +1

Query: 265 CSKVVCSMHCSCDSSVC 315
           C  +V    CSC SSVC
Sbjct: 13  CRDIVWLRSCSCHSSVC 29


>EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium
           channel alpha1 subunit protein.
          Length = 1893

 Score = 23.0 bits (47), Expect = 7.3
 Identities = 8/18 (44%), Positives = 14/18 (77%)
 Frame = +2

Query: 512 RNIELVERMHSRLRRACK 565
           R  + ++R++ RLRRAC+
Sbjct: 462 RKRKTIDRINRRLRRACR 479


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 597,858
Number of Sequences: 2352
Number of extensions: 11852
Number of successful extensions: 23
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 23
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 56347938
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -