SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20018
         (688 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ974172-1|ABJ52812.1|  409|Anopheles gambiae serpin 13 protein.       29   0.18 
AF230521-1|AAF36974.2|  185|Anopheles gambiae homeobox transcrip...    25   2.2  
AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR ...    24   5.2  
DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domai...    23   9.0  
AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         23   9.0  
AY062208-1|AAL58569.1|  503|Anopheles gambiae cytochrome P450 CY...    23   9.0  

>DQ974172-1|ABJ52812.1|  409|Anopheles gambiae serpin 13 protein.
          Length = 409

 Score = 28.7 bits (61), Expect = 0.18
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +3

Query: 399 KDIYRTEPDKIKFQQLRKLFTDRGPTFPYHWDVPVAWLCSKLLSVNSRNRY*HK 560
           ++IY    + + F+Q   L       FP  +   +  L S LLS+ SRNRY H+
Sbjct: 99  QEIYSAVAETVDFRQKDMLLRHMSGDFPRDYVDTLKQLRSPLLSI-SRNRYRHE 151


>AF230521-1|AAF36974.2|  185|Anopheles gambiae homeobox
           transcription factor protein.
          Length = 185

 Score = 25.0 bits (52), Expect = 2.2
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = -3

Query: 296 WYTEYRERNSQCENSSKGTPDVTVDG 219
           W+   R +  +  ++S  TPD+T DG
Sbjct: 53  WFQNRRMKAKKDNSASANTPDLTYDG 78


>AY347946-1|AAR28374.1|  640|Anopheles gambiae putative NPY GPCR
           protein.
          Length = 640

 Score = 23.8 bits (49), Expect = 5.2
 Identities = 12/49 (24%), Positives = 20/49 (40%), Gaps = 4/49 (8%)
 Frame = +1

Query: 538 PGIDTNTRAARSVRTSHRYSRTSAGSDDDEPHHKLPNC----NHICWLG 672
           PG   N+R  R  ++  ++S+ +       PH     C       CW+G
Sbjct: 337 PGEAENSRDQRMAKSKRKFSQQNCCEQQHLPHVHSEKCAGTQTGECWIG 385


>DQ370045-1|ABD18606.1|  285|Anopheles gambiae putative TIL domain
           protein protein.
          Length = 285

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 10/22 (45%), Positives = 13/22 (59%)
 Frame = +2

Query: 437 STTEEAVHGSRAYIPVSLGRSC 502
           STT  +V  S+  IPV+ G  C
Sbjct: 184 STTGSSVRPSKGLIPVAPGAKC 205


>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 9/23 (39%), Positives = 14/23 (60%)
 Frame = -3

Query: 344  QTGVVMATRALHRLLQWYTEYRE 276
            +TG    +R L RLLQ + E+ +
Sbjct: 1965 ETGAAATSRELARLLQGFEEFEQ 1987


>AY062208-1|AAL58569.1|  503|Anopheles gambiae cytochrome P450
           CYP6M1 protein.
          Length = 503

 Score = 23.0 bits (47), Expect = 9.0
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +3

Query: 351 VVRDSIDYLQAHGLKSKD 404
           VVRD+IDY   +G++  D
Sbjct: 252 VVRDTIDYRVKNGIQRND 269


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 550,147
Number of Sequences: 2352
Number of extensions: 11537
Number of successful extensions: 69
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 69
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 69
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 69413730
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -