SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20017
         (763 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles ...    26   1.1  
AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.           25   3.4  
AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.           25   3.4  
AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.           25   3.4  
AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.           25   3.4  
AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.           25   3.4  
AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.           25   3.4  

>M93689-2|AAA29367.1|  975|Anopheles gambiae protein ( Anopheles
           gambiae T1 retroposon. ).
          Length = 975

 Score = 26.2 bits (55), Expect = 1.1
 Identities = 19/70 (27%), Positives = 31/70 (44%)
 Frame = -3

Query: 551 SLISYTYIFRSLAGPAGTHNKM*RARSFEAARMRHALWNRALITY*PFEREPSIVRLSMR 372
           +L+S T IFRS   P  ++  +   +      +R    NR+   +  F+   S  RL  R
Sbjct: 319 ALLSCTPIFRSPPNPPWSNRTLRNLKKDRMKYLRRYRLNRSAFNFRLFKYAASAHRLYNR 378

Query: 371 IKYGASEYRL 342
            ++ A   RL
Sbjct: 379 ARFEAYSSRL 388


>AY341224-1|AAR13788.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -1

Query: 601 SEPVLEAFSGSGRINNKVSLVTPTFLDH 518
           +EP++    GSG I+NK+SL      D+
Sbjct: 65  AEPLIVGRRGSGTISNKLSLQHVQLFDY 92


>AY341223-1|AAR13787.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -1

Query: 601 SEPVLEAFSGSGRINNKVSLVTPTFLDH 518
           +EP++    GSG I+NK+SL      D+
Sbjct: 65  AEPLIVGRRGSGTISNKLSLQHVQLFDY 92


>AY341222-1|AAR13786.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -1

Query: 601 SEPVLEAFSGSGRINNKVSLVTPTFLDH 518
           +EP++    GSG I+NK+SL      D+
Sbjct: 65  AEPLIVGRRGSGTISNKLSLQHVQLFDY 92


>AY341221-1|AAR13785.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -1

Query: 601 SEPVLEAFSGSGRINNKVSLVTPTFLDH 518
           +EP++    GSG I+NK+SL      D+
Sbjct: 65  AEPLIVGRRGSGTISNKLSLQHVQLFDY 92


>AY341220-1|AAR13784.1|  287|Anopheles gambiae TOLL9 protein.
          Length = 287

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -1

Query: 601 SEPVLEAFSGSGRINNKVSLVTPTFLDH 518
           +EP++    GSG I+NK+SL      D+
Sbjct: 65  AEPLIVGRRGSGTISNKLSLQHVQLFDY 92


>AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.
          Length = 576

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = -1

Query: 601 SEPVLEAFSGSGRINNKVSLVTPTFLDH 518
           +EP++    GSG I+NK+SL      D+
Sbjct: 292 AEPLIVGRRGSGTISNKLSLQHVQLFDY 319


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 737,989
Number of Sequences: 2352
Number of extensions: 13765
Number of successful extensions: 22
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79002570
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -