SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20015
         (627 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         24   3.4  
CR954257-5|CAJ14156.1|  227|Anopheles gambiae predicted protein ...    23   6.0  

>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 24.2 bits (50), Expect = 3.4
 Identities = 10/24 (41%), Positives = 12/24 (50%)
 Frame = -1

Query: 564 LRQASVNPVSPCWTLHQLLFCLKS 493
           L  A   P   CW LH L  CL++
Sbjct: 194 LHGAGCTPERLCWELHYLERCLRA 217


>CR954257-5|CAJ14156.1|  227|Anopheles gambiae predicted protein
           protein.
          Length = 227

 Score = 23.4 bits (48), Expect = 6.0
 Identities = 9/32 (28%), Positives = 14/32 (43%)
 Frame = +2

Query: 434 RCTAKCSGDRSRYSYKST*SDFKQNNNWCKVQ 529
           +CT      R+   Y+       QNN  CK++
Sbjct: 122 KCTRNVCTGRNEVPYREQCVKLHQNNRLCKIE 153


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 601,257
Number of Sequences: 2352
Number of extensions: 11676
Number of successful extensions: 17
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61050630
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -