SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20014
         (597 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.           24   4.3  
DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.       23   7.5  
AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical prote...    23   7.5  
AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical prote...    23   7.5  
AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.           23   7.5  

>M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein.
          Length = 1212

 Score = 23.8 bits (49), Expect = 4.3
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -2

Query: 257 VSTCEQTVLTAASSFLDPN 201
           +S CE+T+    SSF DP+
Sbjct: 328 ISACEKTMQRMTSSFPDPH 346


>DQ974164-1|ABJ52804.1|  410|Anopheles gambiae serpin 4C protein.
          Length = 410

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = +1

Query: 355 LRYVTSWVRNTSEG 396
           +RY+ SWV N + G
Sbjct: 84  VRYINSWVHNQTHG 97


>AJ439060-1|CAD27752.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 11/43 (25%), Positives = 20/43 (46%)
 Frame = -3

Query: 277 LVTPLIMFLHVNRLSSRRQAPFWIRTISQPSGDEGLPCECQQP 149
           LVT ++   +  R+++     F+ R  S P G +  P +   P
Sbjct: 339 LVTDVLSEFYNRRIAANANGLFYDRAGSVPGGSDSAPPKSNPP 381


>AJ438610-9|CAD27481.1|  763|Anopheles gambiae hypothetical protein
           protein.
          Length = 763

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 11/43 (25%), Positives = 20/43 (46%)
 Frame = -3

Query: 277 LVTPLIMFLHVNRLSSRRQAPFWIRTISQPSGDEGLPCECQQP 149
           LVT ++   +  R+++     F+ R  S P G +  P +   P
Sbjct: 339 LVTDVLSEFYNRRIAANANGLFYDRAGSVPGGSDSAPPKSNPP 381


>AF444782-1|AAL37903.1|  576|Anopheles gambiae Toll9 protein.
          Length = 576

 Score = 23.0 bits (47), Expect = 7.5
 Identities = 9/29 (31%), Positives = 15/29 (51%)
 Frame = -2

Query: 287 LEAFSYSFNHVSTCEQTVLTAASSFLDPN 201
           LE    S+N++S   Q +LT  ++    N
Sbjct: 206 LEQLDLSYNYISAWNQQILTTTTALQSVN 234


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 643,977
Number of Sequences: 2352
Number of extensions: 14638
Number of successful extensions: 18
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 18
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 57609459
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -