SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20009
         (710 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14...    25   3.1  
AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small...    24   4.1  
AJ271117-1|CAB88872.1|  355|Anopheles gambiae serine protease pr...    24   5.4  
AY752903-1|AAV30077.1|   93|Anopheles gambiae peroxidase 9 protein.    23   7.2  
AJ302654-1|CAC35519.1|  168|Anopheles gambiae gSG2-like protein ...    23   7.2  
AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro...    23   7.2  
AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.         23   9.5  
AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    23   9.5  
AF117749-1|AAD38335.1|  372|Anopheles gambiae serine protease 14...    23   9.5  

>AF007166-1|AAB62929.1|  360|Anopheles gambiae serine protease 14D
           protein.
          Length = 360

 Score = 24.6 bits (51), Expect = 3.1
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = +2

Query: 260 CCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPW 379
           CC    S   T+L ESP+  + L  R+       +   PW
Sbjct: 82  CCAGVRSKGKTSLPESPNCGVQLTDRVLGGQPTKIDEFPW 121


>AJ438610-3|CAD27475.1|  190|Anopheles gambiae putative RHO small
           GTPase protein.
          Length = 190

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = +3

Query: 402 WFPVLHHHCQD 434
           W+P + HHC D
Sbjct: 100 WYPEIKHHCPD 110


>AJ271117-1|CAB88872.1|  355|Anopheles gambiae serine protease
           protein.
          Length = 355

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 11/40 (27%), Positives = 15/40 (37%)
 Frame = +2

Query: 260 CCKEGTSPTITALGESPSTAISLKTRISPLSTLDLASSPW 379
           CC        ++   SP   I +  RI    T +L   PW
Sbjct: 77  CCASEQQTRTSSFPTSPECGIQVTDRIIGGQTTELEEFPW 116


>AY752903-1|AAV30077.1|   93|Anopheles gambiae peroxidase 9 protein.
          Length = 93

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -1

Query: 674 HLNYLYWEGIFIYQEDLVFN 615
           H+NY  W  IF+  E++V N
Sbjct: 24  HINYYEWLPIFLGWENMVKN 43


>AJ302654-1|CAC35519.1|  168|Anopheles gambiae gSG2-like protein
           protein.
          Length = 168

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 14/53 (26%), Positives = 19/53 (35%)
 Frame = +1

Query: 253 HFMLQGGDFTNHNGTGGKSIYGNKFEDENFTLKHTGPGVLSMANAGADTNGSQ 411
           H   +GGD ++ N TG          D  F  +   PG  +    G    G Q
Sbjct: 22  HHHSRGGDGSSANSTGNSDNNSAGVPDFGFNSQSNVPGFGNGQQPGQQQQGQQ 74


>AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein.
          Length = 2051

 Score = 23.4 bits (48), Expect = 7.2
 Identities = 12/36 (33%), Positives = 17/36 (47%)
 Frame = -2

Query: 118  VNSDVEEYSW*RHFAGISNVSNLQNHHNDNASLVNA 11
            +NSD E Y+W   F     ++ L  H  DN   + A
Sbjct: 1704 MNSDYE-YNWKNGFGEDEQITILARHGEDNQLFLKA 1738


>AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein.
          Length = 2259

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 9/26 (34%), Positives = 14/26 (53%)
 Frame = -1

Query: 122 HRQQ*RRRILVVETFCRY*QCKQFTK 45
           H QQ   +  ++  FCR  +CK+  K
Sbjct: 427 HHQQVHNQQRILYCFCRNVECKELEK 452


>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
           channel alpha subunitprotein.
          Length = 2139

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = +2

Query: 275 TSPTITALGESPSTAISLKTRISPLSTLDLASSPW 379
           T+PT TA G + +  +S        ++L L  SP+
Sbjct: 524 TAPTATAAGTAKARKVSAGVATIQKASLSLPGSPF 558


>AF117749-1|AAD38335.1|  372|Anopheles gambiae serine protease 14D2
           protein.
          Length = 372

 Score = 23.0 bits (47), Expect = 9.5
 Identities = 10/25 (40%), Positives = 16/25 (64%)
 Frame = -1

Query: 497 LTTSMPSTTFPKTTCLPSSQEVLTV 423
           L+ ++  T F +  CLP+S+E  TV
Sbjct: 226 LSETVEFTDFIRPICLPTSEESRTV 250


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 808,108
Number of Sequences: 2352
Number of extensions: 18180
Number of successful extensions: 43
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 42
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 43
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 72758970
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -