SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20008
         (705 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF079312-1|AAC28093.1|  271|Anopheles gambiae 60S ribosomal prot...    91   3e-20
M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.              25   1.8  
CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos...    24   4.1  
AY028783-1|AAK32957.1|  499|Anopheles gambiae cytochrome P450 pr...    24   4.1  
AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein p...    24   4.1  
AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein...    24   5.4  
AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein p...    24   5.4  
AJ439060-12|CAD27763.1|  450|Anopheles gambiae putative tachykin...    23   7.1  
AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   9.4  
AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.            23   9.4  
AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.            23   9.4  

>AF079312-1|AAC28093.1|  271|Anopheles gambiae 60S ribosomal protein
           rpL7a protein.
          Length = 271

 Score = 91.1 bits (216), Expect = 3e-20
 Identities = 41/63 (65%), Positives = 51/63 (80%)
 Frame = +2

Query: 509 VTKLVEKKKAQLWSSLMMLIPLSWFLFLPALCRKMGVPYCIVKGKSRLGALVHRKTCTCL 688
           V K+VE+KKAQL      + P+   ++LPALCRKMGVPYCI+KGK+RLG LV+RKTCTC+
Sbjct: 149 VVKMVEQKKAQLVIIAHDVDPIELVVYLPALCRKMGVPYCIIKGKARLGTLVYRKTCTCV 208

Query: 689 ALT 697
           ALT
Sbjct: 209 ALT 211



 Score = 84.6 bits (200), Expect = 3e-18
 Identities = 42/92 (45%), Positives = 52/92 (56%)
 Frame = +3

Query: 234 LVQICKMPKYIRIQRQKAVLQRRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPETXXXX 413
           L +  K PKYIRIQR +A+LQ+RLK+PPPINQFTQTLDK TA+ + K  +KYRPE     
Sbjct: 57  LSRFVKWPKYIRIQRHRAILQKRLKIPPPINQFTQTLDKPTAQQVMKCWKKYRPENPIAR 116

Query: 414 XXXXXXXXXXXXXXXXXXXXXRPNTIRSGTNT 509
                                R N +R G N+
Sbjct: 117 VQRLKAKAEAKAAGKEEPPSKRANQLRQGINS 148



 Score = 56.0 bits (129), Expect = 1e-09
 Identities = 42/144 (29%), Positives = 58/144 (40%), Gaps = 2/144 (1%)
 Frame = +1

Query: 169 NPLFEKRPKNFAIGQGIQPTRDLSRFVRCPSISASSARRLYFSVV*KCPLRSTNLPRHWT 348
           NPLFEKR KN+ IGQ +QP RDLSRFV+ P        R       K P       +   
Sbjct: 35  NPLFEKRVKNYGIGQNVQPKRDLSRFVKWPKYIRIQRHRAILQKRLKIPPPINQFTQTLD 94

Query: 349 RLQLRAFSRFWRN-TXXXXXXXXXXXXXXXXXXXXXXXMSLHQRGPTPSDPAQTRHQAGR 525
           +   +   + W+                              +R         +  +   
Sbjct: 95  KPTAQQVMKCWKKYRPENPIARVQRLKAKAEAKAAGKEEPPSKRANQLRQGINSVVKMVE 154

Query: 526 EEEGAVVVIAHDVDPIEL-VSLPA 594
           +++  +V+IAHDVDPIEL V LPA
Sbjct: 155 QKKAQLVIIAHDVDPIELVVYLPA 178


>M93690-1|AAA29364.1|  613|Anopheles gambiae ORF1 protein.
          Length = 613

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 7/16 (43%), Positives = 12/16 (75%)
 Frame = -2

Query: 686 SMCMSCGVQVHRGGTC 639
           ++C+ CG + H+ GTC
Sbjct: 572 NVCIRCGQEGHKAGTC 587


>CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon
            polyprotein protein.
          Length = 1726

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 10/33 (30%), Positives = 17/33 (51%)
 Frame = -2

Query: 407  CFSLRPVFLQNLEKALSCSLVQCLGKLVDRRGH 309
            CF  + V ++ +    S + +  L + V RRGH
Sbjct: 1454 CFVTKAVHIELVSNLTSSAFLAALRRFVARRGH 1486


>AY028783-1|AAK32957.1|  499|Anopheles gambiae cytochrome P450
           protein.
          Length = 499

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 9/34 (26%), Positives = 21/34 (61%)
 Frame = +3

Query: 297 RRLKVPPPINQFTQTLDKTTAKGLFKILEKYRPE 398
           R+L++     + T+T+++  A+ +   L ++RPE
Sbjct: 229 RKLRLKVCSRELTETVERVAAEAINSKLHEHRPE 262


>AB090821-1|BAC57917.1|  353|Anopheles gambiae gag-like protein
           protein.
          Length = 353

 Score = 24.2 bits (50), Expect = 4.1
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = -2

Query: 686 SMCMSCGVQVHRGGTC 639
           S+C+ CG   HR  +C
Sbjct: 311 SLCLHCGAADHRAASC 326


>AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein
           coupled receptor protein.
          Length = 695

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 9/29 (31%), Positives = 16/29 (55%)
 Frame = -2

Query: 446 LSFSSFPQPLFPGCFSLRPVFLQNLEKAL 360
           + F  F QP+F  C+ L  + L+N+   +
Sbjct: 506 IKFGLFFQPIFSVCWFLEVIALENVHSCV 534


>AB090813-1|BAC57901.1|  724|Anopheles gambiae gag-like protein
           protein.
          Length = 724

 Score = 23.8 bits (49), Expect = 5.4
 Identities = 10/41 (24%), Positives = 20/41 (48%)
 Frame = -3

Query: 244 IWTSPELAECPDQWQSSLASSRREDSRSSWAQPF*PPMGRR 122
           +WT+  +  CP Q Q  L   +++  +    + + PP  R+
Sbjct: 419 LWTTV-VRSCPSQRQRQLQQQQQQQQQQQQGERYVPPQLRQ 458


>AJ439060-12|CAD27763.1|  450|Anopheles gambiae putative tachykinin
           receptor protein.
          Length = 450

 Score = 23.4 bits (48), Expect = 7.1
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = -3

Query: 250 LQIWTSPELAECPDQWQSSLASSRR 176
           L++W S  + EC  +   ++ S RR
Sbjct: 270 LELWGSKSIGECTQRQLDNIKSKRR 294


>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.0 bits (47), Expect = 9.4
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = +2

Query: 485  HHPIRHKHVTKLVEKKKAQLWSSLMMLIPLSWFLFLPALC 604
            HH   HK +  + E K  ++W +L     L+     P+LC
Sbjct: 2308 HHTF-HKEIKGIDEAKSKKIWDALREKSFLTTDCTNPSLC 2346


>AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein.
          Length = 3320

 Score = 23.0 bits (47), Expect = 9.4
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 4/43 (9%)
 Frame = +1

Query: 502  QTRHQAGREEEGAVVVIAH-DVDPI---ELVSLPASVMP*NGR 618
            +TR+Q   +EEG VV   H  ++ I    L + P+ +M  +GR
Sbjct: 2460 ETRYQVEHDEEGNVVRATHKGIERIIYDPLFNRPSKIMLSDGR 2502


>AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein.
          Length = 3318

 Score = 23.0 bits (47), Expect = 9.4
 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 4/43 (9%)
 Frame = +1

Query: 502  QTRHQAGREEEGAVVVIAH-DVDPI---ELVSLPASVMP*NGR 618
            +TR+Q   +EEG VV   H  ++ I    L + P+ +M  +GR
Sbjct: 2461 ETRYQVEHDEEGNVVRATHKGIERIVYDPLFNRPSKIMLSDGR 2503


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 694,942
Number of Sequences: 2352
Number of extensions: 13761
Number of successful extensions: 37
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 32
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71922660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -